KEGG   Sus scrofa (pig): 396920
Entry
396920            CDS       T01009                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00480  Glutathione metabolism
ssc00590  Arachidonic acid metabolism
ssc01100  Metabolic pathways
ssc04918  Thyroid hormone synthesis
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    396920 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    396920 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    396920 (GPX5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    396920 (GPX5)
   05016 Huntington disease
    396920 (GPX5)
   05022 Pathways of neurodegeneration - multiple diseases
    396920 (GPX5)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     396920 (GPX5)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 396920
NCBI-ProteinID: NP_999051
Ensembl: ENSSSCG00000001214
UniProt: O18994
Position
7
AA seq 219 aa
MTVQLGAFYLFPLFMAGFVQTNSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGK
HVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYV
RPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWN
FEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgactgtacagttaggggccttctatcttttccctcttttcatggctggcttcgtgcag
acaaattccaatctggagaagatggattgctacaaagacgtgacaggcaccatctatgac
tatgacgctttcactcttaatggaaacgaacacattcagttcaagcagtacgcgggcaag
catgtcctttttgtcaatgtggctacctattgtggtctgacagcccagtatcctgaactg
aatacacttcaggaggagctgaagccttttggcctagttgtgttgggctttccctgcaac
caatttgggaagcaagaaccaggagaaaactcagagatccttctgggattgaagtatgtc
cgtccagggggaggatatgtacctaatttccagctttttgagaaaggggacgtgaatggt
gaaaaagaacagaaagtcttcaccttcttgaagcattcctgtcctcacccttctgagctt
attggctcaatcggatatatatcttgggaacccatcagggtccacgacatccgctggaat
tttgaaaagttcctggtagggcctgatggagtccctgtcatgcgctgggtccatgagact
cccatcagtacagtcaagtccgatattctggcatacctgaaacagttcaaaactgaatga

DBGET integrated database retrieval system