KEGG   Sus scrofa (pig): 396924Help
Entry
396924            CDS       T01009                                 

Gene name
AKR1A1
Definition
(RefSeq) alcohol dehydrogenase [NADP(+)]
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00040  Pentose and glucuronate interconversions
ssc00561  Glycerolipid metabolism
ssc01100  Metabolic pathways
Module
ssc_M00014  Glucuronate pathway (uronate pathway)
ssc_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    396924 (AKR1A1)
   00040 Pentose and glucuronate interconversions
    396924 (AKR1A1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    396924 (AKR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    396924 (AKR1A1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     396924 (AKR1A1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396924 (AKR1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 396924
NCBI-ProteinID: NP_999055
Ensembl: ENSSSCG00000029256
UniProt: P50578
Structure
PDB: 

AA seq 325 aa AA seqDB search
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEAL
TETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEK
YNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIV
PMLTVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcctgtgtcctcctgcatactgggcagaagatgcccctgattggactaggc
acctggaagagcgagcctggccaggtgaaagccgctattaaatacgccctgactgtaggc
taccgccacattgactgtgctgctatctacggcaatgagcttgagatcggggaggctctg
acggagaccgtgggacccggcaaggcggtgcctcgggaggaactgttcgtgacttccaag
ctgtggaacacgaagcaccaccccgaggatgtggagcccgccctccggaagaccctggct
gacctccagctcgagtatttggacctgtacctgatgcactggccctacgcctttgagcgg
ggcgacaaccccttccccaagaatgccgacgggaccatacgctatgacgccacccactac
aaggacacctggaaggccctggaggcactggtggccaaggggctggtgcgggccctgggc
ctgtccaacttcagcagtcggcagatcgatgacgtgctcagcgtggcctcggtgcgcccc
gctgtcctgcaggtggaatgccacccatacctggctcagaacgagctgattgcccactgc
caagcacgcggcctggaggtgactgcttacagccctctggggtcctctgatcgtgcgtgg
cgtgaccctaatgagcctgtcctgcttgaggagcccgtggtccaggcactggctgaaaag
tataaccggtctccagctcagatcttgctcaggtggcaggtccagcggaaagtgatctgc
atccccaagagtgtcacaccttcccgcatccctcagaacatccaggtgtttgacttcacc
tttagcccagaggagatgaagcagctggatgccctgaataagaacttgcgattcatcgtg
cctatgcttacggtggatgggaagagagtcccaagagatgcaggccatcctctgtacccc
tttaatgacccgtattga

DBGET integrated database retrieval system