KEGG   Sus scrofa (pig): 396924
Entry
396924            CDS       T01009                                 

Gene name
AKR1A1
Definition
(RefSeq) alcohol dehydrogenase [NADP(+)]
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00040  Pentose and glucuronate interconversions
ssc00053  Ascorbate and aldarate metabolism
ssc00561  Glycerolipid metabolism
ssc00620  Pyruvate metabolism
ssc01100  Metabolic pathways
ssc01240  Biosynthesis of cofactors
ssc05208  Chemical carcinogenesis - reactive oxygen species
Module
ssc_M00014  Glucuronate pathway (uronate pathway)
ssc_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    396924 (AKR1A1)
   00040 Pentose and glucuronate interconversions
    396924 (AKR1A1)
   00053 Ascorbate and aldarate metabolism
    396924 (AKR1A1)
   00620 Pyruvate metabolism
    396924 (AKR1A1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    396924 (AKR1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    396924 (AKR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    396924 (AKR1A1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     396924 (AKR1A1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396924 (AKR1A1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 396924
NCBI-ProteinID: NP_999055
Ensembl: ENSSSCG00000029256
UniProt: P50578
Structure
PDB: 

AA seq 325 aa
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEAL
TETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEK
YNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDALNKNLRFIV
PMLTVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcttcctgtgtcctcctgcatactgggcagaagatgcccctgattggactaggc
acctggaagagcgagcctggccaggtgaaagccgctattaaatacgccctgactgtaggc
taccgccacattgactgtgctgctatctacggcaatgagcttgagatcggggaggctctg
acggagaccgtgggacccggcaaggcggtgcctcgggaggaactgttcgtgacttccaag
ctgtggaacacgaagcaccaccccgaggatgtggagcccgccctccggaagaccctggct
gacctccagctcgagtatttggacctgtacctgatgcactggccctacgcctttgagcgg
ggcgacaaccccttccccaagaatgccgacgggaccatacgctatgacgccacccactac
aaggacacctggaaggccctggaggcactggtggccaaggggctggtgcgggccctgggc
ctgtccaacttcagcagtcggcagatcgatgacgtgctcagcgtggcctcggtgcgcccc
gctgtcctgcaggtggaatgccacccatacctggctcagaacgagctgattgcccactgc
caagcacgcggcctggaggtgactgcttacagccctctggggtcctctgatcgtgcgtgg
cgtgaccctaatgagcctgtcctgcttgaggagcccgtggtccaggcactggctgaaaag
tataaccggtctccagctcagatcttgctcaggtggcaggtccagcggaaagtgatctgc
atccccaagagtgtcacaccttcccgcatccctcagaacatccaggtgtttgacttcacc
tttagcccagaggagatgaagcagctggatgccctgaataagaacttgcgattcatcgtg
cctatgcttacggtggatgggaagagagtcccaagagatgcaggccatcctctgtacccc
tttaatgacccgtattga

DBGET integrated database retrieval system