KEGG   Sus scrofa (pig): 396948
Entry
396948            CDS       T01009                                 

Gene name
HSD11B2
Definition
(RefSeq) corticosteroid 11-beta-dehydrogenase isozyme 2
  KO
K00071  corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00140  Steroid hormone biosynthesis
ssc01100  Metabolic pathways
ssc04960  Aldosterone-regulated sodium reabsorption
Module
ssc_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    396948 (HSD11B2)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    396948 (HSD11B2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     396948 (HSD11B2)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Epimerase
Other DBs
NCBI-GeneID: 396948
NCBI-ProteinID: NP_999078
Ensembl: ENSSSCG00000002777
UniProt: Q8MKG1
Position
6
AA seq 400 aa
MESWPWPSGGAWLLVAARALLQLLRADLRLGRPLLAALALLAALDWLCQRLLPPLAALVV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKATAKKLDAMGFTVLATVLELDSPG
AQELRACCSPRLKLLQMDLTKPADISRVLEFTKVHTASTGLWGLVNNAGHNILVADAELS
PVATYRSCMEVNFFGTLEMTKALLPLLRRSSGRIVTVSSPAGDMPFPCLSAYGTSKAAVA
LLMDSFSCELQPWGVKVSVIQPACFRTEAVKNVDQWEERKRQLLATLPQELLQAYGEDYI
EHLNGQFLHSLSQGLPDLSPVVDAITDALLAAKPRHRYYPGHGLGLMYFIHYYLPEGLRR
RFLQSFFISPYVPRALRLGQPSHTSAQDPGPNLGSAPTAQ
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggagagctggccctggccgtcgggcggcgcctggctgctcgtggcggcccgtgcgctg
ctgcagctgctgcgcgcagacctgcgtctgggccgcccgctgctggcggcgctggcgctt
ctggccgcgctcgactggctgtgccagcgcctgctgcccccgctggccgcacttgtcgtg
ctggctgccgcgggttggatcgcgttgtcccgcttggcgcggccgcaacgcctgccggtg
gcgactcgcgcggtgctcatcaccggctgtgactccggttttggcaaagcgactgccaag
aagctggatgccatgggcttcacagtgctggccaccgtgttggagttggatagccctggt
gcccaagagctgcgtgcttgctgttcccctcgtctgaagttgctgcagatggacctgacc
aagccagcagacattagccgcgtgctggagttcaccaaggtccacactgccagcacaggt
ctgtggggcctggtcaacaatgcaggccacaacatccttgtggcagatgcagagctgtct
ccagtggccacgtaccgcagctgcatggaggtgaatttttttggtacccttgagatgacc
aaagccctcttgccactgctgcgccggtcgagcggtcgcattgtgactgtgagcagtcca
gcaggagatatgccatttccgtgcttgtctgcctacgggacctccaaagcggctgtggca
ttgctcatggactctttcagctgtgaacttcagccctggggggtcaaggtcagcgtcatc
cagcctgcctgcttcaggacggaggcagtgaaaaacgtggaccagtgggaagagcgcaag
cggcagctgctggccactctgccccaagagctgctacaggcctatggtgaggactacatc
gagcacttgaatgggcaatttctgcactctctgagccaggggctgccagacctcagcccg
gttgtagatgccatcactgacgcactgctggcggctaagccgcgccaccgctattaccct
ggccatggcctggggctcatgtacttcatccactactacctgccagagggcctgcgacgc
cgtttcctgcagtccttcttcatcagtccctatgtgcccagagcactgaggcttggccag
cccagccatacctctgcccaggatccaggcccaaacctgggctctgcccccaccgctcaa
tga

DBGET integrated database retrieval system