KEGG   Sus scrofa (pig): 396954
Entry
396954            CDS       T01009                                 
Symbol
PROC
Name
(RefSeq) vitamin K-dependent protein C precursor
  KO
K01344  protein C (activated) [EC:3.4.21.69]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    396954 (PROC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    396954 (PROC)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.69  protein C (activated)
     396954 (PROC)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   396954 (PROC)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 hEGF DUF1986 EGF_2 cEGF EGF_CA
Other DBs
NCBI-GeneID: 396954
NCBI-ProteinID: NP_999083
Ensembl: ENSSSCG00000023693
UniProt: Q9GLP2
Position
15:complement(25043543..25054310)
AA seq 459 aa
MWQLASLLLLLIIWAVSSTPVPPDSVFSSSQRAHQMLRSKRANSFLEELRPSSLERECKE
ETCDFEEAREIFQNTENTMAFWSKYHDGDQCAVSPPEHLCDSPCCGRGTCIDGLGGFRCD
CAQGWEGRFCLHEVRFSNCSTENGGCAHYCLEEEGGRRCACAPGYRLGDDHLQCEPKVRS
PCGRLGNRMEKKRKNLKRDTDQVDKKEDQIDPRLVNGKQSPWGESPWQVILLDSKKKLAC
GAVLIHVSWVLTAAHCLDDYKKLTVRLGEYDLRRREKWEVDLDIKEFLVHPNYTRSTSDN
DIALLRLAEPATFSQTIVPICLPDSGLSERELTRVGQETVVTGWGYRSEAKTNRSFILNF
IKVPVAPHNECVQAMHNKISENMLCAGILGDSRDACEGDSGGPMVASFRGTWFLVGLVSW
GEGCGRLHNYGVYTKVSRYLDWIHGHIRMEEAFHKNQVP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtggcaacttgcaagcctcttactgctcctgatcatctgggcagtttccagcacacca
gttcctcctgactcagtgttctccagcagccagcgggcccaccagatgctgcgcagcaaa
cgcgccaactccttcctggaggagctgcggcccagcagcctggagcgtgagtgcaaggag
gagacctgtgatttcgaggaggctcgggagattttccaaaacacggaaaacacaatggcc
ttctggtccaagtaccatgacggggaccagtgcgcggtctcgccccctgagcacctgtgc
gacagcccgtgctgcgggcgtggcacctgtatcgacggcctgggcggcttccgctgcgac
tgcgctcagggctgggagggccgcttctgcctgcacgaggtgcgcttctccaactgctcg
acggaaaacggtggctgtgcgcactactgcctggaggaggagggcgggcgccgctgcgct
tgcgcgccaggctaccggctgggggacgaccacctgcagtgcgagccaaaggtgaggtcc
ccttgcgggaggctagggaatcgcatggagaagaaacgcaagaacttgaagcgtgataca
gaccaagttgacaaaaaagaagaccaaatagatccgaggctcgtcaatgggaagcagtcc
ccatggggagagagcccctggcaggtgatcctgctggactcaaagaagaagctggcctgt
ggggcagtgctcatccatgtctcctgggtgctgacagcggcccactgcttggacgactac
aagaagctcactgtcaggctcggcgaatatgatctgaggcgtcgggaaaaatgggaggta
gacctggacatcaaggagttcctcgtccaccctaactacaccaggagcaccagtgacaat
gacatcgccctgctccgcctggccgaaccggccactttctcgcagaccatcgtgcccatc
tgcctcccagacagtggcctctctgagcgtgagctcacccgggttggccaagagacggtg
gtgaccggctggggctaccgcagcgaggccaagacaaaccgcagcttcatcctcaacttc
atcaaggtccctgtggccccgcacaatgagtgcgtccaggccatgcacaacaagatctct
gagaacatgctgtgtgcaggcatcctgggggactctcgtgatgcctgcgagggcgacagc
ggggggcctatggtggcctccttccgcggcacctggttcctggtgggcctggtgagctgg
ggtgagggctgtgggcgcctccacaactatggcgtttacaccaaagtcagccgttacctc
gactggatccatggccacatcagaatggaggaggccttccacaagaaccaggtgccttag

DBGET integrated database retrieval system