KEGG   Sus scrofa (pig): 396958Help
Entry
396958            CDS       T01009                                 

Gene name
HEXB
Definition
(RefSeq) beta-hexosaminidase subunit beta precursor
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00511  Other glycan degradation
ssc00520  Amino sugar and nucleotide sugar metabolism
ssc00531  Glycosaminoglycan degradation
ssc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
ssc00604  Glycosphingolipid biosynthesis - ganglio series
ssc01100  Metabolic pathways
ssc04142  Lysosome
Module
ssc_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    396958 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    396958 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    396958 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    396958 (HEXB)
   00511 Other glycan degradation
    396958 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    396958 (HEXB)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     396958 (HEXB)
Chaperones and folding catalysts [BR:ssc03110]
 Intramolecular chaperones
  Others
   396958 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b NCD1
Motif
Other DBs
NCBI-GeneID: 396958
NCBI-ProteinID: NP_999086
Ensembl: ENSSSCG00000014073
UniProt: Q29548 D0G6X8
Position
2
AA seq 538 aa AA seqDB search
MAMERHGWRWLPGLLALLAALVVPKGWARDTSGAESLGLWPLPFAVDISPRSLHLSPNNF
FFGHSPTSKAGSSCEILQEAFRRYYDFIFGFYKWHQGSYQLCFGTELQQLQVHVESECDT
FPSISSNESYVLHVKGPEALLRANTVWGALRGLETFSQLIYQDSYGTFTVNESEIIDFPR
FPHRGILIDTGRHFLSVKTIFKTLDAMAFNKFNVLHWHIVDDQSFPYQSINFPLLSSKGS
YSLSHVYTPNDVRMVIEYARIRGIRVMPEFDTPGHSRSWGKGQKDLLTPCYRKQVLSGTF
GPINPILNTTYNFLSKFFKEISTVFPDEFIHIGGDEVDFDCWASNSEILQFMQEKGFSKN
FTKLQSFYVFKISNMISAMKKRPIVWQEAFDGRDKFMPGTVVQVWKIEDYKWEQSLITKA
GFPVILSAPWYLDLISYGQDWKNYYEVEPQDFPGSDKERKRVLGGEACLWGEYVDATNLT
PRLWPRASAVGERLWSHKDVRDIHDAYSRLTIHRCRMVRRGIAAEPLFTGYCNHEHRM
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctatggagcgccacggatggaggtggctacccggcctcctggcgctgctggcggct
ctggtggtgccgaaagggtgggccagggacacctctggcgcggagagcctgggtctgtgg
cccttgccctttgccgtggatatatccccgcgctcgcttcacctctctcccaacaacttt
ttcttcggccacagccccacttccaaagccggctcctcctgtgaaatccttcaggaagcg
tttcggcgatattatgactttatttttggtttctacaagtggcatcaaggctcttaccag
ttatgttttggcacggaattgcagcagcttcaagtccacgtggagtcggagtgtgacact
ttccccagcatctcttcaaatgagtcctatgttttacatgtaaaaggaccagaggccttg
ctcagggccaacacagtttggggagctttgcgaggtttagagacctttagccagttaatt
tatcaagattcttatgggactttcaccgtcaatgaatccgaaattatagattttccgagg
tttcctcatagaggaattttaattgacacagggcgacacttcctgtcagtaaagaccatt
tttaaaactctggatgccatggcttttaataagtttaatgttctccactggcacatagtt
gatgaccagtctttcccttatcagagcatcaattttcctctactaagcagtaagggaagc
tattctttgtctcatgtttatacaccaaatgatgttcggatggtgattgaatatgcccga
atacgagggattcgggtcatgccagaatttgatacccctggccattcacggtcttgggga
aaaggccagaaagacctcctgacgccatgttatagaaaacaagttctctctgggactttt
ggacctattaaccctattttgaatacaacttataacttcctgtctaaatttttcaaagaa
attagtaccgtgtttccagatgaattcattcatattggaggagatgaagtagactttgat
tgttgggcatccaattcagaaatcctgcagttcatgcaggaaaaaggctttagcaaaaat
ttcactaaactccaatctttctacgtgttcaagatttcaaatatgatttcagccatgaag
aagagacccatagtctggcaagaggcttttgatggcagagacaagtttatgcccggcaca
gtagttcaggtatggaaaatagaagactataaatgggaacaaagtcttattacgaaagct
ggcttccctgtgatcctttctgctccatggtacttagacttgatcagttatggacaagat
tggaagaattactatgaagtggaacctcaagattttcctggttctgacaaagagagaaag
cgtgtccttggcggagaagcttgcctatggggagaatatgtggatgcaaccaaccttact
ccaagactatggcctcgagcaagtgctgttggtgagagactctggagtcataaagatgtc
cgagacatacatgatgcctacagcagactaaccattcaccgctgcagaatggtcaggcga
ggaatagctgcagaacctctctttactggctactgtaaccatgagcacagaatgtaa

DBGET integrated database retrieval system