KEGG   Sus scrofa (pig): 396961Help
Entry
396961            CDS       T01009                                 

Gene name
APEH
Definition
(RefSeq) acylamino-acid-releasing enzyme
  KO
K01303  acylaminoacyl-peptidase [EC:3.4.19.1]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    396961 (APEH)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.1  acylaminoacyl-peptidase
     396961 (APEH)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   396961 (APEH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S9 Hydrolase_4 Abhydrolase_1 DLH Peptidase_S15 Abhydrolase_3 Abhydrolase_2 Abhydrolase_6 COesterase BAAT_C Esterase_phd Esterase
Motif
Other DBs
NCBI-GeneID: 396961
NCBI-ProteinID: NP_999088
Ensembl: ENSSSCG00000011385 ENSSSCG00000021476
UniProt: P19205
Position
13
AA seq 732 aa AA seqDB search
MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGRYRTVHTEWTQRDLERMEN
IRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGTAEEKQF
LEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLLYVADKKRPKAESFFQTK
ALDVTGSDDEMARTKKPDQAIKGDQFLFYEDWGENMVSKSTPVLCVLDIESGNISVLEGV
PESVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLTGGKCELLSDESV
AVTSPRLSPDQCRIVYLRFPSLVPHQQCGQLCLYDWYTRVTSVVVDIVPRQLGEDFSGIY
CSLLPLGCWSADSQRVVFDSPQRSRQDLFAVDTQMGSVTSLTAGGSGGSWKLLTIDRDLM
VVQFSTPSVPPSLKVGFLPPAGKEQAVSWVSLEEAEPFPDISWSIRVLQPPPQQEHVQYA
GLDFEAILLQPSNSPEKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGS
TGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDAGRVALMGGSHGGFLSCHLIGQY
PETYSACVVRNPVINIASMMGSTDIPDWCMVEAGFSYSSDCLPDLSVWAAMLDKSPIKYA
PQVKTPLLLMLGQEDRRVPFKQGMEYYRVLKARNVPVRLLLYPKSTHALSEVEVESDSFM
NAVLWLCTHLGS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcaggtgctgctgagcgagcccgaagaggcggcggcgctgtaccggggcctt
agccgccagcccgcgctgagcgccgcctgcctgggcccagaggtcaccacgcagtacggg
ggtcgctaccggactgtgcacactgagtggacccagagggacctggaacgcatggagaac
atccgattctgccgccagtacctggtgttccatgatggggactcagtggtgtttgcaggg
cctgcaggcaacagtgtggagacccggggggagctgctgagcagagagtctccttcaggc
accatgaaagccgtgctgcgcaaggctggaggcacgggcactgcggaggagaagcagttt
ttggaggtctgggagaagaaccggaagctcaagagcttcaacctgtcagcgctggagaaa
catgggccggtttatgaggacgactgctttggctgcttgtcctggtcgcactcggagaca
cacttattatatgtggcagacaagaagcgccccaaggctgagtcgttctttcagaccaaa
gccctggacgtcactggcagcgatgatgagatggccaggacaaagaagccagaccaggcc
attaagggggatcagtttttgttttacgaagattggggagaaaacatggtttccaaaagt
actcctgtgctctgcgtgctggatattgagagcggcaacatctctgtgcttgagggggtt
cctgagagtgtgtcccctggacaggcattctgggcccctggagacacaggtgtggtgttc
gtgggctggtggcatgagcccttccggctgggcattcgcttctgtaccaatcgaaggtca
gccctgtactatgtagacctcactggggggaagtgtgagctcctctcagatgagtctgtg
gctgtcacatctccccggctaagtccagatcaatgtcgcatcgtctacctgcggttccca
tctctggtcccccatcaacagtgtggccagttgtgcctgtatgactggtataccagggtc
acctcggtggtggtggacattgtgcctcggcagctgggagaggacttctctgggatctac
tgcagccttctgcctctgggatgctggtcagctgacagccagagagtggtttttgactca
cctcagcgcagccggcaggacctgtttgctgtggacacccagatgggcagtgtgacctct
ttaacggctggggggtcaggtggaagctggaagttgctcacaattgaccgggacctcatg
gtggtgcagttctccacgcccagtgtacccccaagcctgaaagttgggttcctgcctccg
gccgggaaggagcaggcggtatcatgggtatccctggaggaggccgagccctttcctgac
atctcttggagcatccgggtactacagccacccccacagcaagagcatgtgcagtatgct
ggccttgactttgaagcaatccttctacagcccagcaactctccagagaagacccaggtg
cccatggtggtcatgccccacgggggaccccattcatcctttgtcactgcctggatgctg
ttcccagccatgctttgcaagatgggttttgcagtactactagtgaactatcgtggctcc
accggctttggccaagacagcatcctttctctccctggcaatgtgggccaccaggatgtg
aaggacgtccagtttgcagtagagcaggtgctccaggaggaacactttgatgcaggccgt
gtggcccttatgggtggttcccatggtggcttcctctcctgccacctgattggtcagtat
ccagagacctacagtgcctgcgtggtgaggaaccctgtgatcaacattgcctccatgatg
ggctccactgacatccctgactggtgcatggtggaggctggcttctcctacagcagcgac
tgcctgccagacctcagtgtgtgggctgcgatgctggacaagtcacccatcaagtatgcc
cctcaggtgaagactccactgttactgatgctaggccaggaggacaggcgtgtgcccttc
aagcagggcatggagtattaccgtgttctcaaggcccggaatgtgccagtccggctcctg
ctttatcccaaaagcacccatgcactatcagaggtggaggtggaatcagacagcttcatg
aatgctgtgctctggctatgcacacacttgggcagctga

DBGET integrated database retrieval system