KEGG   Sus scrofa (pig): 396968
Entry
396968            CDS       T01009                                 

Gene name
GOT2
Definition
(RefSeq) aspartate aminotransferase, mitochondrial precursor
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00220  Arginine biosynthesis
ssc00250  Alanine, aspartate and glutamate metabolism
ssc00270  Cysteine and methionine metabolism
ssc00330  Arginine and proline metabolism
ssc00350  Tyrosine metabolism
ssc00360  Phenylalanine metabolism
ssc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc01210  2-Oxocarboxylic acid metabolism
ssc01230  Biosynthesis of amino acids
ssc04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    396968 (GOT2)
   00270 Cysteine and methionine metabolism
    396968 (GOT2)
   00220 Arginine biosynthesis
    396968 (GOT2)
   00330 Arginine and proline metabolism
    396968 (GOT2)
   00350 Tyrosine metabolism
    396968 (GOT2)
   00360 Phenylalanine metabolism
    396968 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    396968 (GOT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    396968 (GOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssc01007]
    396968 (GOT2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     396968 (GOT2)
Amino acid related enzymes [BR:ssc01007]
 Aminotransferase (transaminase)
  Class I
   396968 (GOT2)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 396968
NCBI-ProteinID: NP_999093
Ensembl: ENSSSCG00000002797
UniProt: P00506 A0A480XZ96
Position
6
AA seq 430 aa
MALLHSGRVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEV
LKSGRYVTVQTISGTGALRIGANFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLHSYR
YYDPKTCGFDFTGALEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATLVKKNNLFA
FFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
AKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRQQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHIVDQIGMFCFTGIKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGY
LAHAIHQVTK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccctgctgcactccggccgcgtcctgtccggagtcgcctccgccttccacccaggc
ctcgctgctgcagcatctgccagagccagctcctggtgggctcatgtggagatggggccc
ccagatcccatcctgggagtcacagaagcctttaagagagacaccaacagcaaaaagatg
aatctgggagttggtgcctaccgggatgataacggaaagccttacgtgctccctagtgtc
cgaaaggcagaggcgcagattgctgcaaaaaatttggacaaagaatacctgcccattgga
ggactggcggaattttgtaaggcatctgcagaactagccctgggtgagaacaatgaggtg
ttgaaaagtggccggtatgtcaccgtgcagaccatttctgggaccggggccctgcggatc
ggagccaattttctgcaaagattttttaagttcagccgagatgtcttcctgccgaaacca
tcctggggaaatcacacccccatcttcagggacgctggcatgcagctgcatagttaccga
tactatgaccccaagacctgcggctttgacttcacaggtgctcttgaggacatttcaaaa
ataccagctcagagtgtaattctcctgcacgcctgtgcccacaatcccacaggagtggac
cctcgtcctgagcagtggaaggagatggccacactggtgaagaaaaacaatctctttgca
ttctttgacatggcctaccaaggctttgccagtggcgatggtaacaaggatgcttgggca
gtgcgccacttcatcgaacagggcatcaatgtttgtctctgccagtcctatgccaagaac
atgggcttatacggtgagcgtgtgggagccttcactgtggtctgcaaagatgctgaggaa
gccaaaagggtggagtcacagttgaagatcttgatccgtcctatgtattccaaccctcct
gtcaacggggcccggattgcctcgaccatcctgaccagcccggatctgcggcaacaatgg
ttgcaggaagtcaagggcatggccgaccgcatcattagcatgaggacccagctggtctcc
aacctcaagaaggagggctcctcccacaactggcagcacatcgttgaccagatcggcatg
ttttgtttcacaggcataaagcctgaacaggtggagcggctgaccaaggagttctccatc
tacatgacaaaggatggccgcatctctgtggcaggggtcacctctggcaatgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system