KEGG   Sus scrofa (pig): 397028
Entry
397028            CDS       T01009                                 

Symbol
HSP90AA1
Name
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04141  Protein processing in endoplasmic reticulum
ssc04151  PI3K-Akt signaling pathway
ssc04217  Necroptosis
ssc04612  Antigen processing and presentation
ssc04621  NOD-like receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04659  Th17 cell differentiation
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc05132  Salmonella infection
ssc05200  Pathways in cancer
ssc05207  Chemical carcinogenesis - receptor activation
ssc05215  Prostate cancer
ssc05417  Lipid and atherosclerosis
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    397028 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    397028 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    397028 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    397028 (HSP90AA1)
   04612 Antigen processing and presentation
    397028 (HSP90AA1)
   04659 Th17 cell differentiation
    397028 (HSP90AA1)
   04657 IL-17 signaling pathway
    397028 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    397028 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    397028 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397028 (HSP90AA1)
   05207 Chemical carcinogenesis - receptor activation
    397028 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    397028 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    397028 (HSP90AA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    397028 (HSP90AA1)
   05418 Fluid shear stress and atherosclerosis
    397028 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    397028 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397028 (HSP90AA1)
   04131 Membrane trafficking [BR:ssc04131]
    397028 (HSP90AA1)
   03051 Proteasome [BR:ssc03051]
    397028 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:ssc03029]
    397028 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397028 (HSP90AA1)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     397028 (HSP90AA1)
Chaperones and folding catalysts [BR:ssc03110]
 Heat shock proteins
  HSP90
   397028 (HSP90AA1)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    397028 (HSP90AA1)
Proteasome [BR:ssc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    397028 (HSP90AA1)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    397028 (HSP90AA1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   397028 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 397028
NCBI-ProteinID: NP_999138
Ensembl: ENSSSCG00000002535
UniProt: O02705
Position
7
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcccgaggaaacccagacccaagaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggaaatcgcccagttgatgtcgttgatcatcaacactttctactcgaac
aaggagatctttctgagggagctcatttccaactcgtccgatgctttggacaagatcaga
tacgaaagcctgacggatcccagtaaactagactccgggaaagagctgcacattaatctc
attccgaacaagcaagaccggaccctcacgatagtggacaccggcatcggcatgaccaag
gccgacttgatcaataaccttggtacgatcgccaagtctgggaccaaggcgttcatggag
gctttgcaggccggtgccgatatctcgatgattggccagttcggtgtcggcttctactct
gcgtacctggtcgctgagaaagtgaccgttatcaccaaacacaacgatgacgagcagtat
gcctgggagtcttctgcaggaggatctttcaccgttaggacagacacaggagaacctatg
ggtcgtggaacaaaggttattctacatctgaaagaagaccaaactgagtacttggaagaa
aggagaataaaggagattgtgaagaaacactctcagtttattggctaccccattactctc
ttcgtggagaaggaacgtgataaagaagtcagtgacgacgaggcggaagaaaaggaagac
aaagaggaagaaaaggagaaagaagagaaggaatctgaggataaaccggagatagaagat
gttggttctgatgaagaggaagaagaaaagaaggatggtgacaagaagaagaagaagaag
atcaaggagaagtatattgatcaagaggaactcaacaagacaaagcctatctggaccaga
aaccccgatgacatcactaatgaagagtacggggagttctataagagcttgaccaatgac
tgggaggatcacttggctgtgaagcacttttcagtcgaagggcagttggagttcagagcc
cttcttttcgtcccaagacgcgctcctttcgacttatttgaaaacagaaagaagaagaac
aacatcaagctgtatgttcgcagagtgttcatcatggacaactgcgaggagctcatccct
gagtatctgaatttcattagaggcgtggtggactctgaggatcttcctctgaacatttct
cgtgagatgttgcaacaaagcaaaattttgaaagtcatcaggaagaatctggtcaagaaa
tgcttggagctctttactgaattggccgaagataaagagaattacaagaagttctatgag
cagttctctaaaaatattaagcttggaatacatgaagattctcaaaatcggaagaagctt
tccgagctgttgaggtactacacttctgcttctggcgacgagatggtttccctcaaggac
tattgcaccagaatgaaggagaaccagaaacacatctattacatcacaggtgagaccaag
gaccaggtggccaactcggccttcgtggaacgtctgcggaagcacggcctggaggtgatc
tacatgatcgagcccatcgatgagtactgtgtgcagcagctgaaggagtttgaggggaag
accttagtgtcagtcaccaaagagggcctggagctcccggaagatgaagaggagaagaag
aaacaggaggagaagaagacaaagtttgaaaacctctgcaagatcatgaaggacatcttg
gagaagaaagtcgaaaaggtggttgtgtcgaaccggttggtgacctcaccgtgctgcatt
gtcacaagcacatacggctggacagcaaacatggagagaatcatgaaggctcaagccctg
agagacaactcgacaatgggttacatggcagcaaagaagcacctggagataaatccagac
cattccatcatcgagaccctgaggcaaaaggcagaggcggacaagaacgacaagtccgtg
aaggatctggtcatcctgctgtacgaaaccgctctgctgtcttctggcttcagcctggaa
gatccccagacgcacgccaacaggatctacaggatgatcaaacttggtcttggtattgat
gaggacgaccccaccgccgacgacagcagcgctgctgtgacggaggagatgccacccctg
gaaggggacgacgacacgtcccgcatggaggaagtcgattag

DBGET integrated database retrieval system