KEGG   Sus scrofa (pig): 397033
Entry
397033            CDS       T01009                                 

Gene name
B2M
Definition
(RefSeq) beta-2-microglobulin precursor
  KO
K08055  beta-2-microglobulin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04612  Antigen processing and presentation
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    397033 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397033 (B2M)
   05170 Human immunodeficiency virus 1 infection
    397033 (B2M)
   05168 Herpes simplex virus 1 infection
    397033 (B2M)
   05163 Human cytomegalovirus infection
    397033 (B2M)
   05169 Epstein-Barr virus infection
    397033 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397033 (B2M)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   397033 (B2M)
SSDB
Motif
Pfam: C1-set Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 397033
NCBI-ProteinID: NP_999143
Ensembl: ENSSSCG00000004687
UniProt: Q07717 B2NJ26
Structure
PDB: 

Position
1
AA seq 118 aa
MAPLVALVLLGLLSLSGLDAVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLL
KNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
NT seq 357 nt   +upstreamnt  +downstreamnt
atggctcccctcgtggccttggtcctgctcgggctgctctcactgtctggcctggatgcg
gtcgcgcgtcccccgaaggttcaggtttactcacgccacccagcggaaaacggaaagcca
aattacctgaactgctatgtatctgggttccatccgccccagattgaaattgatttgctg
aaaaacggggagaagatgaacgcggagcagtcagacctgtctttcagcaaggactggtct
ttctaccttctggtccacactgagttcactcctaacgctgtggatcagtatagctgccgc
gtgaagcacgtgactctcgataagcccaagatagttaagtgggatcgagaccactaa

DBGET integrated database retrieval system