KEGG   Sus scrofa (pig): 397073Help
Entry
397073            CDS       T01009                                 

Gene name
ABCG2
Definition
(RefSeq) ATP-binding cassette sub-family G member 2
  KO
K05681  ATP-binding cassette, subfamily G (WHITE), member 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01523  Antifolate resistance
ssc02010  ABC transporters
ssc04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    397073 (ABCG2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    397073 (ABCG2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    397073 (ABCG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397073 (ABCG2)
   04147 Exosome [BR:ssc04147]
    397073 (ABCG2)
   04090 CD molecules [BR:ssc04090]
    397073 (ABCG2)
Transporters [BR:ssc02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    397073 (ABCG2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   397073 (ABCG2)
CD molecules [BR:ssc04090]
 Proteins
  397073 (ABCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran SMC_N AAA_21 AAA_23 ABC2_membrane_3 RsgA_GTPase AAA_29 DUF1774 SpecificRecomb
Motif
Other DBs
NCBI-GeneID: 397073
NCBI-ProteinID: NP_999175
Ensembl: ENSSSCG00000009213
Vega: OTTSUSG00000002317
UniProt: Q8MIB3
Position
8
AA seq 656 aa AA seqDB search
MSSNSYQVSIPMSKRNTNGLPGSSSNELKTSAGGAVLSFHDICYRVKVKSGFLFCRKTVE
KEILTNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPHGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLPTTMTNHEKNERINMVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAREALGYFASIGYNCEPYNNPADFFLDVING
DSSAVVLSRADRDEGAQEPEEPPEKDTPLIDKLAAFYTNSSFFKDTKVELDQFSGGRKKK
KSSVYKEVTYTTSFCHQLRWISRRSFKNLLGNPQASVAQIIVTIILGLVIGAIFYDLKND
PSGIQNRAGVLFFLTTNQCFSSVSAVELLVVEKKLFIHEYISGYYRVSSYFFGKLLSDLL
PMRMLPSIIFTCITYFLLGLKPAVGSFFIMMFTLMMVAYSASSMALAIAAGQSVVSVATL
LMTISFVFMMIFSGLLVNLKTVVPWLSWLQYFSIPRYGFSALQYNEFLGQNFCPGLNVTT
NNTCSFAICTGAEYLENQGISLSAWGLWQNHVALACMMVIFLTIAYLKLLLLKKYS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaatagttaccaagtttcaatcccgatgtcaaaaaggaacaccaatggcctg
ccggggtccagctccaatgagctgaagacgtctgctgggggagctgtgttaagctttcat
gacatctgctatcgagtgaaagtgaagagtggctttcttttttgtcggaaaacggttgag
aaggaaatactgacgaacatcaatgggatcatgaaacctggcctcaatgccattctggga
cccacaggtggaggcaaatcttcgttgttagatgtcttagctgcaaggaaagatccgcat
ggattatctggagatgttttgatcaatggagcacctcgacctgccaattttaaatgtaac
tcaggttacgtggtacaggatgacgtcgtgatgggaacgctgacagtgagagaaaactta
cagttctcggcagctcttcggcttccgaccaccatgacaaatcatgaaaaaaatgagcgg
attaacatggtcattcaagagttgggtctggataaagtggccgattccaaggtgggaacc
cagtttatccgtggtgtgtctggaggagaaagaaaacggactagtattgcaatggagctt
attactgacccgtctatcttgttcctggatgagcccacgactggcttagactccagcaca
gcaaatgctgtccttttgctcctgaagaggatgtctaaacaaggacggaccatcatcttc
tccattcatcagcctcgttactccatctttaagttgtttgatagcctcaccttgttggcc
tcaggaagactcatgttccatggacctgctcgggaggccttgggatactttgcctccatc
ggttacaactgtgagccctacaacaaccccgcagacttcttcctggacgtcattaacggc
gactcctccgctgtggtgttaagcagagcggacagagacgagggagcccaagagcccgaa
gagcctcccgagaaagatactcccctcatagacaaacttgctgcgttttataccaactcc
tccttcttcaaggacacgaaggttgagttagatcagttctcagggggtcggaagaagaag
aagagctcggtgtacaaggaggtcacctacaccacctccttctgtcatcagctccgatgg
atttccaggcgttccttcaaaaacttactgggtaatccccaggcgtccgtagcccagata
attgtgacgatcatcctgggcctggttataggtgccattttctatgatctgaaaaatgat
ccctcaggaatccagaacagagccggagtgctcttcttcctgacaaccaaccagtgtttc
agcagcgtctcggccgtggagctccttgtggtggagaagaaactctttatacatgaatat
atcagtggatactacagagtgtcatcttatttcttcggaaaactgttatcggatttacta
cccatgaggatgttaccaagcattatctttacttgtataacgtacttcttgttaggactg
aagcccgcggtggggtccttcttcatcatgatgtttaccctgatgatggtggcgtactca
gccagttccatggccctggccatagccgccggtcagagcgtggtctccgtggcaacactt
ctcatgaccatctcgtttgtgttcatgatgatcttttcggggctgttggtgaatctcaaa
acggtcgtgccttggctctcgtggttacagtacttcagcattcctcgatacggcttttcg
gctttgcagtataatgagtttttgggacaaaacttctgcccgggactcaacgtcacaaca
aacaatacctgtagcttcgcaatatgtactggcgccgagtatttggaaaaccagggcatc
agtctctccgcttggggcctgtggcagaatcacgtggccttggcgtgcatgatggtcatt
ttcctgacgatcgcctacctgaaactgctactcctcaaaaaatactcctaa

DBGET integrated database retrieval system