KEGG   Sus scrofa (pig): 397076
Entry
397076            CDS       T01009                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04620  Toll-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04940  Type I diabetes mellitus
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05143  African trypanosomiasis
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05162  Measles
ssc05164  Influenza A
ssc05168  Herpes simplex virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05321  Inflammatory bowel disease
ssc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    397076 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397076 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    397076 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    397076 (IL12B)
   04625 C-type lectin receptor signaling pathway
    397076 (IL12B)
   04658 Th1 and Th2 cell differentiation
    397076 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397076 (IL12B)
   05205 Proteoglycans in cancer
    397076 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    397076 (IL12B)
   05164 Influenza A
    397076 (IL12B)
   05162 Measles
    397076 (IL12B)
   05168 Herpes simplex virus 1 infection
    397076 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    397076 (IL12B)
   05134 Legionellosis
    397076 (IL12B)
   05152 Tuberculosis
    397076 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397076 (IL12B)
   05145 Toxoplasmosis
    397076 (IL12B)
   05140 Leishmaniasis
    397076 (IL12B)
   05142 Chagas disease
    397076 (IL12B)
   05143 African trypanosomiasis
    397076 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    397076 (IL12B)
   05330 Allograft rejection
    397076 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    397076 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397076 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397076 (IL12B)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interleukins
   397076 (IL12B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Cytokines
   397076 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_2 Ig_4 fn3 I-set
Other DBs
NCBI-GeneID: 397076
NCBI-ProteinID: NP_999178
Ensembl: ENSSSCG00000017044
Vega: OTTSUSG00000001434
UniProt: Q28938
Position
16
AA seq 324 aa
MHLQQLVVSWFSLVWLASPIVAIWELEKNVYVVELDWYPNAPGEMVVLTCNTPEEDGITW
TSDQSSEVLGTGKTLTIHVKEFGDAGQYTCRKGGAVLSQSLLLLHKKEDGIWSTDILKDQ
KEPKNKSFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGSTDPRGVTCGTATLSEDLG
EYKKYRVECQEGSACPAAEESLPIEVVLEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLN
PLKNSRHVEISWEYPDTWSTPHSYFSLMFGVQVQGKNKREKKDKLFTDQISAKVTCHKDA
NIRVQARDRYYSSSWSEWASVSCN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcaccttcagcagctggttgtctcctggttttccctggtttggctggcatctcccatt
gtggccatatgggaactggagaaaaatgtttatgtcgtagagttggactggtaccccaat
gcccctggagaaatggtggtcctcacctgcaacacccctgaagaagacggcatcacgtgg
acctcagaccagagcagtgaggtcttgggcactggcaaaaccctgaccatccacgtcaaa
gagtttggagatgctggccagtacacctgtcgcaaaggaggcgcagttctgagccagtca
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaagaccag
aaagagcccaaaaacaagagctttctaaaatgtgaggcaaagaattactccggacgtttc
acctgctggtggctgacagcaatcagtactgatttgaaattcagtgtcaaaagcagcaga
ggctccactgacccccgtggcgtgacatgtggcacggcaacgctctcagaggacctcggg
gagtataagaagtacagagtggagtgtcaggagggcagtgcctgcccagccgctgaggag
agcctgcccattgaggtcgtgctggaagctgttcacaagctcaagtatgaaaactatacc
agcagcttcttcatcagggacatcatcaaaccagaccctcccaagaatctgcagctgaat
ccattaaagaattctcgacacgtggagatcagctgggagtaccctgacacctggagcacc
ccacattcctacttttccctgatgtttggtgttcaagttcagggcaagaacaaaagagaa
aagaaagataaactcttcacggaccaaatctcagccaaggttacatgccacaaggatgcc
aacatccgcgtgcaagcccgggaccgctactacagctcctcctggagtgaatgggcatct
gtgtcctgcaattag

DBGET integrated database retrieval system