KEGG   Sus scrofa (pig): 397094
Entry
397094            CDS       T01009                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha precursor
  KO
K04383  interleukin 1 alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04217  Necroptosis
ssc04218  Cellular senescence
ssc04380  Osteoclast differentiation
ssc04640  Hematopoietic cell lineage
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04940  Type I diabetes mellitus
ssc05010  Alzheimer disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05133  Pertussis
ssc05140  Leishmaniasis
ssc05152  Tuberculosis
ssc05162  Measles
ssc05164  Influenza A
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05332  Graft-versus-host disease
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397094 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397094 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    397094 (IL1A)
   04218 Cellular senescence
    397094 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397094 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    397094 (IL1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    397094 (IL1A)
   05162 Measles
    397094 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    397094 (IL1A)
   05152 Tuberculosis
    397094 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    397094 (IL1A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    397094 (IL1A)
   05321 Inflammatory bowel disease
    397094 (IL1A)
   05332 Graft-versus-host disease
    397094 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    397094 (IL1A)
   05020 Prion disease
    397094 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    397094 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    397094 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    397094 (IL1A)
   04932 Non-alcoholic fatty liver disease
    397094 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    397094 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397094 (IL1A)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interleukins
   397094 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1 DUF4937
Other DBs
NCBI-GeneID: 397094
NCBI-ProteinID: NP_999194
Ensembl: ENSSSCG00000008090
Vega: OTTSUSG00000001511
UniProt: P18430
Position
3
AA seq 270 aa
MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNQKSFYDASYEPLPGDGMDKFMPLSTSKTS
KTSRLNFKDSVVMAAANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYSFQS
NMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQL
PVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPK
LFIATRQEKLVHMAPGLPSVTDFQILENQS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaaagtccctgacctctttgaagacctgaagaactgctacagtgaaaatgaagaa
tacagttctgatatcgaccatctctctctgaatcagaagtccttctatgatgccagctat
gagccacttcctggggacggcatggataaatttatgcctctgagtacctctaaaacctct
aagacatccaggctaaacttcaaggacagtgtggtgatggcagcagccaacgggaagatt
ctgaagaagagacggttgagtttaaatcagttcatcaccgatgacgacctggaagccatt
gccaatgacacagaagaagaaatcatcaagcccagatcagcaacatacagcttccagagc
aacatgaaatacaacttcatgagggtcatcaaccaccagtgcatcctgaatgatgcccgc
aatcaaagcatcattcgagacccgtcaggtcaatacctcatggctgctgtgctaaataac
ctggatgaggcagtgaaatttgacatggctgcttatacatcaaatgatgattcgcaactt
cctgtgactctaagaatctcagaaacccgactgtttgtgagtgctcaaaacgaagacgaa
cccgtgttgctgaaggagctgcctgagacacccaaaaccatcaaagatgagaccagtctc
ctcttcttctgggaaaagcatggcaatatggactacttcaaatcagccgcccatccaaag
ttgtttattgccacaaggcaggaaaaactggtgcacatggcaccggggctgccctctgtc
actgactttcagatactggaaaaccagtcttga

DBGET integrated database retrieval system