KEGG   Sus scrofa (pig): 397134Help
Entry
397134            CDS       T01009                                 

Gene name
DAO
Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00260  Glycine, serine and threonine metabolism
ssc00330  Arginine and proline metabolism
ssc00472  D-Arginine and D-ornithine metabolism
ssc01100  Metabolic pathways
ssc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    397134 (DAO)
   00330 Arginine and proline metabolism
    397134 (DAO)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    397134 (DAO)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    397134 (DAO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    397134 (DAO)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     397134 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 397134
NCBI-ProteinID: NP_999231
Ensembl: ENSSSCG00000009942
UniProt: P00371
Structure
PDB: 

Position
14
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPS
NPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPR
ELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVESFEEVARGGADVIIN
CTGVWAGVLQPDPLLQPGRGQIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQAVTLGG
TFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERNLLTMPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtggtgattggagcaggcgtcattgggctgtccactgccctctgcatccac
gagcgctaccactctgtcctgcagcccctcgatgtgaaggtctacgcagaccgcttcacc
ccgttcaccaccactgatgtagctgctggcctctggcagccctacacctctgagcccagc
aacccacaggaggcgaactggaaccaacagaccttcaactatctcctgagtcacatcggt
tctcccaatgctgcaaacatgggtctgaccccagtctcaggctacaacctcttccgtgaa
gctgttccggacccttactggaaagacatggtcctgggattccgaaagctgactcccaga
gaactggacatgtttcctgattatagatatggctggttcaacacatccctgattctggag
ggaaggaagtacctacagtggctgacagaaaggttaactgagaggggagtgaaattcttc
ctgaggaaggtggaatcttttgaggaggtggcaagaggtggcgctgatgtgattatcaac
tgcactggggtgtgggctggggtgctgcaaccggatcccctgctgcagccaggccggggg
cagatcattaaggtggatgccccttggctgaagaacttcattatcacccatgacctagag
agaggcatctacaactctccatacatcattccagggctgcaggcagtgacacttggaggc
accttccaggtggggaactggaatgagataaataatatccaggaccacaacaccatctgg
gaaggctgctgcagactggagcccacactgaaggatgcaaaaattgttggtgaatatact
ggcttccggccagtacgcccccaggttcggctagaaagagaacagcttcgctttggatct
tcaaacacagaggtcatccacaactatggccatggaggctatgggctcaccatccactgg
ggctgtgccctagaggtggccaagctctttgggaaagtcctggaagaaaggaatttgctc
acaatgccaccatcccacctctga

DBGET integrated database retrieval system