KEGG   Sus scrofa (pig): 397171
Entry
397171            CDS       T01009                                 

Gene name
OCA2
Definition
(RefSeq) P protein
  KO
K24200  P protein
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397171 (OCA2)
Transporters [BR:ssc02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   397171 (OCA2)
SSDB
Motif
Pfam: CitMHS Na_sulph_symp ArsB
Other DBs
NCBI-GeneID: 397171
NCBI-ProteinID: NP_999259
Ensembl: ENSSSCG00000015854
UniProt: Q8MIQ9
Position
15
AA seq 845 aa
MRLENREGRPTSGVLEMELPQASAPSRAGLGSLGLVGLDSSNHRPQQGGSKAGSRGPYLS
GAAGQSCWVPMDQDFGPFLTERRSHCPFPKHFSSRSKDPCFTENTPLLGSFSQEEGSRCI
PVYRPEFITADEPWENSSAEWEGGALLSTELAVSSGSASTEKGELLDSAHIRCHLSKLRC
CVQWLKVSGLFVFVVLCSILFSLYPDQGKFWQLLAVSPLESYSVNLSSHADSMLLQVDLA
GALVASGPSHLGKEEHVAVEVTQANAPGSRRRRPQQVTHNWTIFLNPSGGEHTVMSRTFE
VLSREPVSINIRASLQQTQIVPLLMAHQYLRASIEAQVTIAAVILAGVYVLIIFEIVHRT
LAAMLGSLAALAALAVIGDRPTLTQVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVK
AYQLSRGRVWAMIIMLCLIAAVLSAFLDNVTTALLFTPVTIRLCEVLNLDPRQVLIAEVI
FTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFAGICFVLLFSFPLLRLLYWN
RKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRGLLLEKVLSLERLLARRLHSF
HRQISQEDKNWETNIQELQKKHRISDRTLLTKCVTVLGLVIFMFFLNSFVPGVHLDLGWI
AILGAIWLLILADIHDFEIILHRVEWATLLFFAALFILMEALAHLHLIEYVGEQTALLIK
MVPEDQRLAAAIIVVVWVSAIASSLIDNIPFTATMIPVLLNLSRDPEISLPAPPLMYALA
LGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCMVGMCYLLVAHV
VMGWN
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgcgtctagagaacagagaaggcaggccgacctctggcgtgctggagatggagctccct
caggcgtctgcccccagccgtgctggcctaggaagtctggggctggtgggactcgacagc
agcaaccacaggccacagcagggaggcagcaaggcaggctcccggggcccctacctcagt
ggggctgctgggcagagctgctgggttcctatggaccaggattttggcccattcctcacg
gagcggaggtctcactgtcctttccccaagcatttcagctccaggtccaaagacccctgc
tttacggaaaacactcctttgcttggaagtttctcccaagaggaagggtcacggtgcata
cctgtttaccgtccagagttcatcactgctgatgaaccttgggagaacagctcagctgag
tgggagggaggagccctgctgagcacagagttggcagtttcttctggatctgcctccaca
gagaagggggagcttctggacagcgctcacatcaggtgccatctttccaagctaaggtgc
tgtgtgcaatggctgaaagtctcaggcttgtttgtctttgtggtgctgtgctctatttta
tttagcctgtatccagatcaaggaaagttctggcagttgttggctgtgtcaccgctggaa
agctattctgtgaacctcagcagccatgcagactccatgctgctccaggtggacctggca
ggggccctggtggccagcggtccaagtcatctcgggaaagaagagcatgtggccgtggag
gtgacccaggctaacgctccaggatccaggcggcggcggccacagcaggtcactcataac
tggacgatatttttaaatccaagtggaggcgagcacacggtgatgagcaggacctttgag
gttctgagcagagagcctgtttccatcaacattcgagcctccctccagcagacccagatt
gttcctcttttgatggctcatcagtacctccgtgcaagcattgaagcacaagtgaccatt
gctgcggtcatccttgctggggtctatgtgctgattatatttgagatcgttcatagaaca
ctggcggctatgttgggttcccttgcagcattagcagcactggctgtgattggtgacaga
cctaccctgacccaggtggtggagtggattgattttgagacgctggccctgctgtttggc
atgatgatcttagtagccatattttcagaaactggattttttgattactgtgctgtaaag
gcataccaactgtcccggggaagagtgtgggccatgatcatcatgctgtgtctcattgct
gctgtcctttctgccttcctggacaacgttaccacggcactcctcttcactcctgtgacc
ataagattgtgtgaggtgctcaacctcgatccaagacaagtcctgattgcagaggtgatc
ttcacaaacattggaggagctgccactgccattggggacccgccaaatgtcattattgtt
tccaaccaggaattgaggaagatgggcctggacttcgctggcttcaccgcccacatgttt
gctgggatttgctttgttctcttgttctcctttccactcctcagactcctttactggaac
agaaagctttataacaaggaacccagtgagattgttgaactgaagcacgagatccacgtc
tggcgcttgactgcacagcgcatcagcccagccagccgcgaggagacagcggttcgaggc
ctgctcctggaaaaggtgctgtcactggagcgcctgctggcccgaaggctgcacagcttc
cacagacagatctcccaggaagataaaaattgggagaccaatatccaggagctacagaaa
aagcacaggatatcagacaggactctgctcaccaaatgcgtgactgtactgggattggtc
atcttcatgttctttctcaattcctttgtccctggtgttcatcttgatctcgggtggatt
gctattctgggtgccatctggctgctaattttagctgatattcatgattttgagataatt
ctacaccgagtagaatgggcgacccttctgttctttgcagcactctttattctgatggag
gcattggcacatctccacttaatagagtatgtcggagagcagactgctttgctaataaag
atggtcccagaagatcagcgcctagcagctgccatcatcgtagtagtctgggtgtcggcc
attgcctcgtccttgattgacaacatcccattcactgccaccatgattcctgtgctcctg
aacttaagcagagatcctgagatcagcctgcctgcaccaccgctcatgtacgccctggcc
ctcggcgcctgcctgggaggtaacgggacactgattggagcatcagccaatgttgtttgt
gcaggaattgcagagcagcatggatatggattctctttcatggaatttttcaggctgggc
ttcccaatgatggttgtctcctgtatggttgggatgtgttacctccttgttgctcacgtc
gtgatgggatggaattaa

DBGET integrated database retrieval system