KEGG   Sus scrofa (pig): 397196
Entry
397196            CDS       T01009                                 

Gene name
DPEP1
Definition
(RefSeq) dipeptidase 1 precursor
  KO
K01273  membrane dipeptidase [EC:3.4.13.19]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397196 (DPEP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397196 (DPEP1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
    397196 (DPEP1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.19  membrane dipeptidase
     397196 (DPEP1)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M19: membrane dipeptidase family
   397196 (DPEP1)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   397196 (DPEP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Enzymes
  397196 (DPEP1)
SSDB
Motif
Pfam: Peptidase_M19 baeRF_family2
Other DBs
NCBI-GeneID: 397196
NCBI-ProteinID: NP_999273
Ensembl: ENSSSCG00000021971
UniProt: P22412 A0A480I924
Position
6
AA seq 409 aa
MWTSWWLWPLVAVCAADQFRDLAVRIMQDTPVIDGHNDLPWQLLNLFNNQLQDPGANLSS
LAHTHTNIPKLKAGFVGGQFWSAYVPCDTQNRDAVKRTLEQIDVIQRMCQAYPETFACVT
SSTGIRQAFREGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYMTLTHSCNTPWADNWLV
DTGDDKAQSQGLSHFGQSVVKEMNRLGVMIDLAHVSVATMRAALKLSQAPVIFSHSSAYS
LCPHRRNVPDDVLQLVKETGSLVMVNFYNDYVSCSAKANLSQVADHLDHIKKVAGAAAVG
FGGDYDGVSRVPSGLEDVSKYPDLVAELLRRQWTEAEVRGALADNLLRVFEAVEQASNHA
QVPGEEPIPLGQLEASCRTNYGYSAAPSLHLPPGSLLASLVPLLLLSLP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtggaccagctggtggctctggcccctggtggccgtctgcgctgcggaccaattccgg
gacctggcggtgaggattatgcaggacacgcctgtcattgacgggcacaatgacctgcct
tggcagctgctgaatctgttcaacaatcagcttcaggacccgggggccaacctctccagc
ctggcccacacgcacaccaacatccccaagctgaaggctggctttgtgggcggccagttc
tggtccgcgtacgtgccctgcgacacccagaacagagacgccgtgaagaggaccctggag
cagatcgacgtcatccagcgcatgtgccaggcgtatcccgagaccttcgcctgcgtcacc
agcagcacaggcatccggcaggccttccgggagggcaaggtggccagcctggtgggcgtg
gagggtggccactccatcgacagcagcctgggcgtcctgcgggccctctaccacctgggc
atgcggtacatgaccctcacccacagctgcaacacgccctgggccgacaactggctggtg
gacacgggcgatgacaaggcccagagccaaggcctgtcgcactttgggcagagcgtcgtg
aaggagatgaaccggctgggcgtcatgatcgacttggcccacgtgtccgtggccaccatg
agggccgctctgaagctgtcccaggcccccgtcatcttcagccactcctcggcctacagt
ctgtgcccgcaccggcgcaacgtgccggatgacgtgctccagctggtgaaggagacgggc
agcctcgtgatggtcaatttctacaacgactacgtttcctgctcggccaaggccaacttg
tcccaagtggcagatcacctggaccacatcaagaaggtggcgggagctgcggccgtgggc
ttcggtggggactacgatggtgtgtccagggtcccctcaggcctggaggacgtgtccaag
tacccagacctggtggccgagctgctcaggaggcagtggacggaggccgaggtcaggggc
gccctggccgacaacctgctgagggtcttcgaggcagtggagcaggccagcaatcacgct
caggttccaggggaggagcccatcccgctgggccagctggaggcttcctgccggacgaat
tacggctactcagccgcccccagcctccacctcccgccgggctcgctgctggcctccctc
gtgcccctcctcctcctcagtcttccgtga

DBGET integrated database retrieval system