KEGG   Sus scrofa (pig): 397197Help
Entry
397197            CDS       T01009                                 

Gene name
CELA2A
Definition
(RefSeq) chymotrypsin-like elastase family member 2A preproprotein
  KO
K01346  pancreatic elastase II [EC:3.4.21.71]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04972  Pancreatic secretion
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    397197 (CELA2A)
   04974 Protein digestion and absorption
    397197 (CELA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397197 (CELA2A)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     397197 (CELA2A)
Peptidases and inhibitors [BR:ssc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   397197 (CELA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 397197
NCBI-ProteinID: NP_999274
Ensembl: ENSSSCG00000003459
UniProt: P08419
Structure
PDB: 

Position
6
AA seq 269 aa AA seqDB search
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggccctactgctgtctacactggtggctggagctctcagctgtgggctcccc
gctaacctgccccaacttcccagggtggttggaggtgaagatgcaaggcccaacagctgg
ccctggcaggtctccctgcagtacgactccagtggccagtggcgccacacctgcggaggg
actttggtggaccagagctgggtcctgacagctgcccactgcatcagctcctccaggacc
taccgcgtggtgctgggccggcacagcctctccaccaatgaacccggttcgctggccgtc
aaggtctccaagctcgtggtgcaccaggactggaactccaaccagctctccaacgggaat
gacattgccctgctcaaactggccagccctgtctccctgaccgacaagatccagctgggc
tgcctgcccgccgccggcaccattctacccaacaactacgtctgctacgtcacaggctgg
ggaaggctgcagaccaacggggcttctcctgacatcctgcagcagggccagctgctggtt
gtggactatgccacgtgctccaagcctggttggtggggcagcactgtgaagaccaacatg
atctgtgcgggtggcgatggcatcatttccagctgcaatggggactccggtgggcctctg
aactgccagggggctaatggccagtggcaagtgcacggcatagtcagcttcgggtcctcc
ctcggttgcaactactaccacaagccctctgtcttcacacgggtctccaactacatcgac
tggatcaactcggtgattgcaaataactaa

DBGET integrated database retrieval system