KEGG   Sus scrofa (pig): 397225Help
Entry
397225            CDS       T01009                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04151  PI3K-Akt signaling pathway
ssc04630  Jak-STAT signaling pathway
ssc04640  Hematopoietic cell lineage
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04672  Intestinal immune network for IgA production
ssc05140  Leishmaniasis
ssc05200  Pathways in cancer
ssc05310  Asthma
ssc05320  Autoimmune thyroid disease
ssc05321  Inflammatory bowel disease (IBD)
ssc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    397225 (IL4)
   04151 PI3K-Akt signaling pathway
    397225 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397225 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    397225 (IL4)
   04660 T cell receptor signaling pathway
    397225 (IL4)
   04658 Th1 and Th2 cell differentiation
    397225 (IL4)
   04659 Th17 cell differentiation
    397225 (IL4)
   04657 IL-17 signaling pathway
    397225 (IL4)
   04664 Fc epsilon RI signaling pathway
    397225 (IL4)
   04672 Intestinal immune network for IgA production
    397225 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397225 (IL4)
  09163 Immune disease
   05310 Asthma
    397225 (IL4)
   05320 Autoimmune thyroid disease
    397225 (IL4)
   05321 Inflammatory bowel disease (IBD)
    397225 (IL4)
   05330 Allograft rejection
    397225 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    397225 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    397225 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397225 (IL4)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interleukins
   397225 (IL4)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Cytokines
   397225 (IL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4 DUF4942
Motif
Other DBs
NCBI-GeneID: 397225
NCBI-ProteinID: NP_999288
Ensembl: ENSSSCG00000014282
Vega: OTTSUSG00000000965
UniProt: Q04745 F1CFE1
Position
2
AA seq 133 aa AA seqDB search
MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAP
ENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLE
RLKTIMKEKYSKC
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatcccaaccctggtctgcttactggcatgtaccagcaac
ttcgtccacggacacaagtgcgacatcaccttacaagagatcatcaaaaccttgaacatt
ctcacagcgagaaagaactcgtgcatggagctgcccgtgacggacgtctttgctgcccca
gagaacacgacggagaaggaaaccttctgccgggcctcgactgtgcttcggcacatctac
agacaccacacgtgcatgaagagcctcctgagcggacttgacaggaacctgagcagcatg
gcaaacatgacctgttctgtgcatgaagccaagaagagcactttgaaagacttcttggaa
aggctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system