KEGG   Sus scrofa (pig): 397247Help
Entry
397247            CDS       T01009                                 

Gene name
NECTIN1
Definition
(RefSeq) nectin-1 precursor
  KO
K06081  poliovirus receptor-related protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04514  Cell adhesion molecules (CAMs)
ssc04520  Adherens junction
ssc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    397247 (NECTIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    397247 (NECTIN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    397247 (NECTIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ssc04515]
    397247 (NECTIN1)
   04090 CD molecules [BR:ssc04090]
    397247 (NECTIN1)
Cell adhesion molecules [BR:ssc04515]
 Immunoglobulin superfamily
  Nectin family
   397247 (NECTIN1)
CD molecules [BR:ssc04090]
 Proteins
  397247 (NECTIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set Herpes_gE
Motif
Other DBs
NCBI-GeneID: 397247
NCBI-ProteinID: NP_001001262
Ensembl: ENSSSCG00000015124
UniProt: Q9GL76
Structure
PDB: 

Position
9
AA seq 515 aa AA seqDB search
MARMGLAGAAGRWWGLALGLTAFFLPGAHTQVVQVNDSMYGFIGTDVVLHCSFANPLPGV
KITQVTWQKATNGSKQNVAIYNPAMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPAGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGKDDKVLVATCTSANGKPP
SVVSWETHLKGEAEYQEIRNPNGTVTVISRYRLVPSREDHRQSLACIVNYHMDRFRESLT
LNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFRGPINYSMAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGQVPTAIIGGV
VGSILLVLFVVGGIVVALCRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPE
DSDDEKKAGPLGGSSYEEEEEEEGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYG
DRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctttaggtttg
accgccttcttcctcccaggtgcccacacccaggtggtccaggtgaacgactccatgtat
ggtttcatcggcacagatgtggtgctgcactgcagcttcgccaaccctctgcctggcgtg
aagatcacccaggtcacgtggcagaaggccaccaatggctccaagcagaacgtggccatc
tacaaccccgccatgggcgtctcggtgctggccccctaccgggagcgtgtggagttcctg
cgaccctccttcactgacggcaccatccgcctctcccgcctggagctggaggacgagggc
gtctacatctgcgagtttgccaccttccctgcaggcaatcgagagagccagctcaacctc
actgtgatggccaaacccaccaactggatagagggcacccaggcggtgcttcgagccaag
aaagggaaggatgacaaggtcctggtggccacctgcacctcggccaatgggaagcctccc
agtgtggtgtcctgggaaacgcacctgaagggcgaggcagagtaccaggagatccggaac
cccaatggcacagtgactgtcatcagccgctaccgcctggtgcccagccgggaagaccac
cggcagtccctggcctgcatcgtcaactaccacatggaccgcttccgggagagcctcacc
ctcaatgtgcagtatgagcccgaggtgaccatcgaggggtttgatgggaactggtacctg
cagcgaatggatgtgaagctgacgtgcaaagctgatgccaaccccccagccaccgagtac
cactggaccacgctgaatggctcccttcccaagggtgtggaggcccagaatagaacgctc
ttcttcaggggacctatcaactacagcatggcaggaacctacatctgtgaggccaccaac
cccatcggtacccgctcgggccaggtggaggtcaatatcacagagttcccctacaccccg
tctcctcccgaacacggccggcgtgcagggcaggtgcccacggccatcattgggggcgtg
gtgggcagcatcctgctggtgctatttgtggtcggcgggatcgtggtggcactgtgtcgg
cgccgtcacaccttcaagggtgactacagcaccaagaagcacgtatacggcaatggctac
agcaaggcgggcatcccccagcaccacccgcccatggcccagaacctgcagtaccccgag
gactcggacgacgagaagaaagccggtcccctgggtggaagcagctacgaggaggaagag
gaggaggagggcggagggggtgagcgcaaggtgggtggcccccaccccaaatacgacgag
gatgccaagcggccctacttcaccgtggatgaggcagaggcccgtcaggacggctacggg
gaccggactctgggctaccagtacgaccctgagcagctggacttggccgagaacatggtt
tctcagaacgacgggtctttcatttccaagaaggagtggtacgtgtaa

DBGET integrated database retrieval system