KEGG   Sus scrofa (pig): 397268
Entry
397268            CDS       T01009                                 

Gene name
UTS2
Definition
(RefSeq) urotensin-2 precursor
  KO
K05248  urotensin 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397268 (UTS2)
SSDB
Motif
Pfam: Urotensin_II
Other DBs
NCBI-GeneID: 397268
NCBI-ProteinID: NP_999308
Ensembl: ENSSSCG00000023079
UniProt: Q95J46
Position
6
AA seq 121 aa
MSKLVPCLLLLGCLGLLFALPVPDSRKEPLPFSAPEDVRSAWDELERASLLQMLPETPGA
EAGEDLREADAGMDIFYPRGEMRKAFSGQDPNIFLSHLLARIKKPYKKRGPPSECFWKYC
V
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtccaagctggtcccctgcttgctcctcctaggatgcttaggtctcctcttcgctctt
cccgtccctgactccaggaaagagcccctgcccttctcagcacctgaagatgtcagatca
gcttgggatgagctggaaagagcctcccttcttcagatgctgccagagacgccaggtgca
gaggcaggagaggatctcagggaagcagatgccggaatggacattttttacccaagagga
gaaatgagaaaggctttctctggacaagatcctaacatttttctgagtcaccttttggcc
agaatcaagaaaccatacaagaaacgtgggcccccctctgaatgcttctggaaatactgt
gtctga

DBGET integrated database retrieval system