KEGG   Sus scrofa (pig): 397276Help
Entry
397276            CDS       T01009                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04137  Mitophagy - animal
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04216  Ferroptosis
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05014  Amyotrophic lateral sclerosis (ALS)
ssc05016  Huntington disease
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397276 (TP53)
   04310 Wnt signaling pathway
    397276 (TP53)
   04071 Sphingolipid signaling pathway
    397276 (TP53)
   04151 PI3K-Akt signaling pathway
    397276 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    397276 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    397276 (TP53)
   04210 Apoptosis
    397276 (TP53)
   04216 Ferroptosis
    397276 (TP53)
   04115 p53 signaling pathway
    397276 (TP53)
   04218 Cellular senescence
    397276 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    397276 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    397276 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    397276 (TP53)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    397276 (TP53)
   05230 Central carbon metabolism in cancer
    397276 (TP53)
   05202 Transcriptional misregulation in cancer
    397276 (TP53)
   05206 MicroRNAs in cancer
    397276 (TP53)
   05205 Proteoglycans in cancer
    397276 (TP53)
   05203 Viral carcinogenesis
    397276 (TP53)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    397276 (TP53)
   05212 Pancreatic cancer
    397276 (TP53)
   05225 Hepatocellular carcinoma
    397276 (TP53)
   05226 Gastric cancer
    397276 (TP53)
   05214 Glioma
    397276 (TP53)
   05216 Thyroid cancer
    397276 (TP53)
   05220 Chronic myeloid leukemia
    397276 (TP53)
   05217 Basal cell carcinoma
    397276 (TP53)
   05218 Melanoma
    397276 (TP53)
   05219 Bladder cancer
    397276 (TP53)
   05215 Prostate cancer
    397276 (TP53)
   05213 Endometrial cancer
    397276 (TP53)
   05224 Breast cancer
    397276 (TP53)
   05222 Small cell lung cancer
    397276 (TP53)
   05223 Non-small cell lung cancer
    397276 (TP53)
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    397276 (TP53)
   05016 Huntington disease
    397276 (TP53)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    397276 (TP53)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    397276 (TP53)
   05162 Measles
    397276 (TP53)
   05161 Hepatitis B
    397276 (TP53)
   05160 Hepatitis C
    397276 (TP53)
   05168 Herpes simplex infection
    397276 (TP53)
   05163 Human cytomegalovirus infection
    397276 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    397276 (TP53)
   05169 Epstein-Barr virus infection
    397276 (TP53)
   05165 Human papillomavirus infection
    397276 (TP53)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    397276 (TP53)
   01522 Endocrine resistance
    397276 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397276 (TP53)
   03036 Chromosome and associated proteins [BR:ssc03036]
    397276 (TP53)
   03400 DNA repair and recombination proteins [BR:ssc03400]
    397276 (TP53)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    397276 (TP53)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     397276 (TP53)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    397276 (TP53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer P53_TAD
Motif
Other DBs
NCBI-GeneID: 397276
NCBI-ProteinID: NP_998989
Ensembl: ENSSSCG00000017950
UniProt: Q9TUB2 A0A1B2TT48
Position
12
AA seq 386 aa AA seqDB search
MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSELSLAAVNDLLLSPVTNWLDENPDDA
SRVPAPPAATAPAPAAPAPATSWPLSSFVPSQKTYPGSYDFRLGFLHSGTAKSVTCTYSP
ALNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDG
LAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMN
RRPILTIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFLKKGQSCPEPPPGSTKRA
LPTSTSSSPVQKKKPLDGEYFTLQIRGRERFEMFRELNDALELKDAQTARESGENRAHSS
HLKSKKGQSPSRHKKPMFKREGPDSD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtcgcagtccgagctgggcgtggagccccctctgagtcaggagacattttca
gacttgtggaaactgcttcctgaaaacaacctgctgtcctctgagctctccctggcagca
gtgaacgatctgctgctgtccccagtcacgaactggctggatgaaaatccagatgacgcc
tccagagtgccagcgcctcctgcagcaacagcgcccgcaccagctgcccccgcaccagcc
acctcctggcccctgtcgtcctttgtcccttctcagaagacctaccctggcagctatgat
ttccgtctagggttcctgcattctggaacagccaagtctgtaacctgcacgtactcccct
gccctcaataagctgttttgccagctggccaagacctgcccggtgcagctgtgggtcagc
tcgccacccccgcctggcacccgtgtccgcgccatggccatctacaagaagtcagagtac
atgaccgaggtggtgaggcgctgtccccaccatgagcgcagctctgactatagcgatggt
ctggcccctccccagcatctcatccgggtggaagggaatttacgggccgagtacttggat
gacagaaacacttttcgacacagcgttgtggtgccctacgagccgcccgaggtcggctct
gactgtaccaccatccactacaacttcatgtgtaacagctcctgcatggggggcatgaac
cggcggcccatcctcaccatcatcacactggaagatgccagtggcaacttgctgggacgg
aacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcacagaggaagaa
aatttcctcaagaagggccaatcttgccccgagcctccccctggcagcactaagcgagca
ctgcccaccagcaccagctcctcgccagtgcaaaagaagaagccactggatggcgagtat
ttcaccctccagatccgtgggcgtgaacgcttcgagatgttccgagagctgaatgacgcc
ttggagctgaaggatgcccagactgcgcgggagtcgggggaaaacagggcccactccagc
cacctgaagtctaagaaggggcagtctccctcccgccataaaaaaccgatgttcaagaga
gaaggacctgactcagactga

DBGET integrated database retrieval system