KEGG   Sus scrofa (pig): 397308
Entry
397308            CDS       T01009                                 

Gene name
SREBF1
Definition
(RefSeq) sterol regulatory element-binding protein 1
  KO
K07197  sterol regulatory element-binding transcription factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04152  AMPK signaling pathway
ssc04910  Insulin signaling pathway
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    397308 (SREBF1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    397308 (SREBF1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    397308 (SREBF1)
   04931 Insulin resistance
    397308 (SREBF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397308 (SREBF1)
   04131 Membrane trafficking [BR:ssc04131]
    397308 (SREBF1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    397308 (SREBF1)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    397308 (SREBF1)
SSDB
Motif
Pfam: HLH GIT_CC
Other DBs
NCBI-GeneID: 397308
NCBI-ProteinID: NP_999322
UniProt: O97676
Position
12
AA seq 1151 aa
MDEPPFTEAALEQALAEPCELDAALLTDIEDMLQLINNQDSDFPGLFDAPYAGVAGGTDP
TSPDASSPGSPTPPPSTMSSPLEGFLGGARTPPPPPVSPTQPAPTPLKMYPSVPAFSPGP
GIKEEPVPLTILQPPTPQPLSGALLPQSLPALAPPQLSPAPVLGYPSPPGSFSSATPPGS
TSQTLPGLPLASLPGVLPVSVHTQVQSAAPQQLLTATATPVVSPGTTTVTSQIQQVPVLL
QPHFIKADSLLLTTMKTDMGTPVKAAGIGSLAPGTAVQAAPLQTLVSGGTILATVPLVVD
TDKLPINRLAAGGKALSSGQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNK
SAVLRKAIDYIRFLQQSNQKLKQENLSLRTAAHKSKSLKDLVSCSSGGRTDVPMEGVKPE
VVDTLSPPPSDAGSPSQSSPLSLGSRGSSSGGSGSDSEPDSPVFEDSQMKPEQLPAPHGR
GMLDRSRLALCVLVFLCLSCNPLASLMGSWALPGPSDATSAYHGPWRSVLGAEGRDGPGW
VLWLLPPLVWLTNGLLVLLFLALLFVYGEPVTRPHSDPAVRFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLRRDSALEA
DTRTSACDAALVYHKLHQLHTMGKYPGGHLDAANLALSALNLAECAGDALSVAVLAEVYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPVAMQWLCHPVGHRFFVDGDWAVC
GAPRDSLYSVAGNPVDPLAQVTQLFREHLLEQALHCVAQPSPGPGSADGDREFSEALGFL
QLLNSCCDTAGAPACSFSIASSTAATAGTDPVAKWWASLTAVVTHWLGRDEEAAERLYPL
VEHLPRALQESERPLPRAALHSFKAARALLGRGKAESGSASLAMCEKASGYLQDSLAATP
AGSSIDKAMQLLLCDLLLVARTSLWQRQKPPPPSQASQGSSSGAQASALELRGFQRDLSG
LRRLAQSFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRRRAGPCGRGGAAAAAAAE
LEPRPTRREQAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLM
RLGGGTTVTSS
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggacgagccgcccttcacagaggcagccttggagcaggcgctggccgagccatgcgag
ctggacgcggcgctgctgaccgacatcgaagacatgcttcagctcatcaacaaccaagac
agcgacttccccggcctgttcgacgcgccctacgctggcgttgcaggaggcacggacccc
accagtcctgatgccagctccccaggcagcccgacgccgcctccttccaccatgagctcc
ccgcttgaaggcttcctggggggggccaggacgccgccaccgccccccgtgtccccaacc
cagcctgcacccaccccgctgaagatgtacccgtcggtgcctgccttctcgcctgggccg
ggcatcaaggaggagccagtgccactgaccatcctgcagccccccaccccacagcccctg
tctggggctctcctgccccagagccttccagccctcgcccctccgcagttgagccctgcc
cccgtgttgggctaccccagccctcctggaagcttctcctcggcgacccctccagggagc
acctcacagacgctgcctggcctgccgctggcctctctgcccggggtcctgcccgtctcc
gtgcacacccaggttcaaagtgcggccccccagcagctgttgacagccacggccaccccc
gtggtgtcccctggaacaaccactgtgacctcgcagatccagcaggtcccggtcctgctg
cagccccacttcatcaaggcggactccctgctcctgacgaccatgaaaacagacatgggg
acccctgtgaaggcggcgggcatcggctccctggcccctggcacagccgtgcaggcagca
cctttgcagaccctggtgagcggcgggaccatcctggcgacggtgcctctggtagtggac
actgacaagctgcccatcaaccgcctggcagctgggggcaaagccctgagctcaggccag
agccgtggtgagaagcggacggctcacaatgccatcgagaaacgctaccgctcctccatc
aatgacaagatcatcgagctcaaggacctggtggtgggcacggaggcgaagctgaataaa
tccgccgtcttgcgcaaggccatcgactacatccgcttccttcagcagagcaaccagaag
ctcaagcaggagaacctgagtctgcggactgctgcccacaaaagcaagtctctgaaggac
ctggtgtcctgcagcagcggaggccgcaccgacgtgcccatggagggtgtgaagccggag
gtggtagacacccttagcccgcccccctccgacgccggctcgccctcccagagcagcccc
ttgtccctcggcagcaggggcagcagcagcggtggcagtggcagtgactcagagcccgac
agcccggtttttgaggacagccagatgaagccagagcagctgccggccccccacggccgg
ggcatgctggaccgctcccgcctggccctgtgcgtgctcgtcttcctctgtctctcctgc
aaccccttggcctcactgatgggcagctgggctctccctggcccctccgatgccaccagc
gcctaccacgggccctggcgcagcgtactgggcgctgagggcagagatggccctggctgg
gtcctgtggctgctgcccccgctggtctggctgacgaatgggctgctggtgctgctcttc
ttggcgcttctctttgtctatggagagccggtcacgcggccccactcggatccagctgtg
cgcttctggaggcatcgcaagcaggccgacctggacctggcccggggggacttcgcccag
gctgcccagcagctgtggctggccctgcgggcgctgggccggcccctgcccacctcccac
ctggacctggcctgcagcctgctctggaacctcatccgccacctgctgcagcgtctctgg
gtgggccgctggctggcgggccgggccgggggcctgcggagggacagcgccctggaggcg
gacacccgcaccagcgcctgtgacgcggccctcgtctaccacaagctgcaccagctgcac
accatggggaagtacccaggcgggcacctcgatgccgccaacctggcgctgagtgccctg
aacctggcggagtgtgcgggtgatgccctgtccgtggccgtgctggcggaggtctatgtg
gccgctgccctgcgagtcaagaccagtctcccccgggccttgcactttctgacccgcttc
ttcctgagtagcgcccgccaggcctgcctggcacaaagcggctcggtgcctgttgccatg
cagtggctctgccaccctgtgggccaccgtttcttcgtggatggggactgggccgtgtgc
ggtgccccccgggacagcttgtacagcgtggctgggaacccagtggaccccctggcccag
gtgactcagttgttccgtgaacacctcttggagcaagccctgcattgcgtggcccagccc
agccccggccctggatcagctgatggggacagggaattctcagaggccctcgggttcctg
cagctgctcaacagctgttgtgacacagccggggctcctgcctgcagcttctccattgcc
tccagcacagccgccacggccggcacagacccggtcgccaagtggtgggcctcgctgacg
gctgtggtgacccactggctggggcgggacgaggaggcggccgagcggctgtacccgctg
gtggagcacctgccccgcgccctgcaggagtccgagagacccctgcccagggcagctctg
cactccttcaaggccgcccgggccctgctgggccgcgggaaggcagagtctggctcagcc
agcctggccatgtgtgagaaggccagtgggtacctgcaggacagcctggccgccacgcca
gccggcagctccattgacaaggccatgcagctgctcctgtgtgacctgctccttgtggcg
cgcaccagcctgtggcagcggcagaagccgcccccaccctcccaggcctcgcagggctcg
agcagcggggcccaggcctctgcgctcgagctgcgcggcttccagagggacctgagtggc
ctgaggcgcctggcgcagagcttccggcctgccatgcggagggtgttcctccatgaggcc
accgccaggctgatggccggggccagccccgcgcggacgcaccagctcctggaccgcagt
ctgaggaggagggcgggcccctgcggcagaggaggcgcggcggccgcggcggcggcggag
ctggaaccgcggcccacgcggcgggagcaggccgaggccctgctgctcgcctcctgctac
ctgccgcccggcttcctgtcggcgccggggcagcgcgtgggcatgctggccgaggcggcg
cgcacgctcgagaagctcggcgaccgccggctgctgcacgactgccagcagatgctcatg
cgcctgggcggcgggaccaccgtgacctccagctag

DBGET integrated database retrieval system