KEGG   Sus scrofa (pig): 397340
Entry
397340            CDS       T01009                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04062  Chemokine signaling pathway
ssc04217  Necroptosis
ssc04630  Jak-STAT signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04917  Prolactin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    397340 (STAT5B)
   04630 Jak-STAT signaling pathway
    397340 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    397340 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    397340 (STAT5B)
   04659 Th17 cell differentiation
    397340 (STAT5B)
   04062 Chemokine signaling pathway
    397340 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    397340 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    397340 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397340 (STAT5B)
   05203 Viral carcinogenesis
    397340 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    397340 (STAT5B)
   05220 Chronic myeloid leukemia
    397340 (STAT5B)
   05223 Non-small cell lung cancer
    397340 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397340 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397340 (STAT5B)
   05162 Measles
    397340 (STAT5B)
   05161 Hepatitis B
    397340 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    397340 (STAT5B)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    397340 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 397340
NCBI-ProteinID: NP_999333
Ensembl: ENSSSCG00000017406
UniProt: Q9TUZ0
Position
12
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADAMSQKHLQINQTFEELRPVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVTLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQRAKSLLKNESTRNDCSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYSGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASSDSAG
GNATYMDQAPSPAVCPQAHYSIYPQNPDPVLDNDGDFDLDDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagca
ctgtatggtcagcatttccccatcgaggtgcggcattatttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatattctgtacaacgaacagaggctggtc
cgagaagccaacaatggtacttctccagctggaagtctcgctgatgccatgtcccagaaa
caccttcagatcaaccagacctttgaggagctgcgaccggtcacgcaggacacggagaat
gagttgaagaagctgcagcagactcaagagtacttcatcatccagtatcaagagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggccctgcagcagaagcaggtgaccctggaggcctggctgcagcgcgaggcccag
accctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacgcagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccgcaggtgaaggccaccatcatcagtgagcagcgggccaag
tcgctgctcaagaacgagagcacccgcaatgattgcagcggcgagatcttgaacaactgc
tgtgtgatggagtatcaccaggccaccggcaccctcagcgcccacttccggaacatgtcg
ctgaaacgaattaagaggtctgaccgtcgtggagcagagtcagtgacagaagaaaaattt
acaatcttatttgaatcacagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctcccagtggtggtgattgttcacggcagccaggacaacaacgcgacggcc
accgtcctctgggacaatgctttcgcagagcccggcagggtgccctttgcggtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaagctcttcaacagc
agcagcagccatctggaggactacagcggcatgtctgtgtcctggtcccagttcaacagg
gaaaatttaccaggacggaattacactttctggcagtggtttgatggcgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaacgatggggctattttgggtttcgtgaacaag
caacaggcccatgacctactcattaacaagcccgacgggactttcctgctgaggttcagt
gactctgaaattggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctctatccggtccctggcagaccgcttg
ggagacctgaattaccttatctacgtgtttcctgatcggccaaaggatgaagtgtactcc
aaatattacaccccagttccatgcgagcctgccaccgctaaagcagtggacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagcgcctcttcagactctgccggg
ggcaatgccacctacatggaccaggccccctccccagccgtgtgcccccaggctcattac
agcatatacccacagaaccccgaccccgtccttgacaacgatggggactttgatctggac
gacacgatggacgtggcgcgtcgtgtggaggagctcttgggccgacctatggacagtcag
tggatccctcacgcgcagtcgtga

DBGET integrated database retrieval system