KEGG   Sus scrofa (pig): 397341Help
Entry
397341            CDS       T01009                                 

Gene name
CPB1
Definition
(RefSeq) carboxypeptidase B precursor
  KO
K01291  carboxypeptidase B [EC:3.4.17.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04972  Pancreatic secretion
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    397341 (CPB1)
   04974 Protein digestion and absorption
    397341 (CPB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397341 (CPB1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     397341 (CPB1)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   397341 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 Intimin_C
Motif
Other DBs
NCBI-GeneID: 397341
NCBI-ProteinID: NP_999334
Ensembl: ENSSSCG00000011694
UniProt: P09955
Structure
PDB: 

Position
13
AA seq 416 aa AA seqDB search
MLAFLILVTVTLASAHHSGEHFEGEKVFRVNVEDENDISLLHELASTRQIDFWKPDSVTQ
IKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSRVRTTGHSYEKYN
NWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVGKPGPNKPAIFMDCGFHAREW
ISHAFCQWFVREAVLTYGYESHMTEFLNKLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTN
AGTTCIGTDPNRNFDAGWCTTGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAY
LTIHSYSQMILYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTNYVLGHL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgttcttgattcttgtgactgtgactctagcatctgctcatcattctggtgag
cactttgaaggtgagaaggtgttccgtgtcaatgttgaagatgaaaatgacatcagctta
ctccatgagttggccagcaccaggcagattgacttctggaaaccagattctgtcacacaa
atcaaacctcacagtacagttgacttccgcgtgaaagcagaagatattttggctgtggaa
gactttctggagcagaatgaactacaatatgaggtactcataaacaacctgagatctgtg
ctagaggctcagtttgacagcagagtccgtacaactggacacagttatgagaagtacaac
aactgggaaacgatagaggcttggactaagcaagtcaccagtgaaaatccagacctcatc
tctcgcacagccatcggaactacatttttaggaaacaatatatacctcctcaaggttggc
aaacctggaccaaataagcctgccattttcatggactgtggtttccatgccagagaatgg
atttcccatgcattttgccagtggtttgtgagagaggctgttctcacctatggatatgag
agtcacatgacagaattcctcaacaagctagacttttatgtcttgcctgtgctcaatatt
gatggctacatctacacctggaccaagaaccgaatgtggagaaagacccgctctaccaat
gctggaactacctgcattggcacagaccccaacagaaattttgatgctgggtggtgcaca
actggagcctctacagacccctgcgatgagacttactgtggatctgctgcagagtctgaa
aaagagaccaaggccctggctgattttatacgcaacaacctctcctccatcaaagcatac
ctgacgatccactcatactcacagatgatactctacccttattcctatgattacaaactc
cccgagaacaatgctgagttgaataacctggctaaggctgccgtgaaagaacttgctaca
ctgtatggcaccaagtacacatacggcccaggagctacaacaatctatcctgctgctggg
ggctctgatgactgggcttatgaccaaggaatcaaatattccttcacctttgaactccgg
gataaaggcagatatggttttatcctccctgaatcccagatccaggcaacctgtgaggaa
acaatgctggccatcaaatacgtaaccaactacgtgctgggccacctgtaa

DBGET integrated database retrieval system