KEGG   Sus scrofa (pig): 397355Help
Entry
397355            CDS       T01009                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04540  Gap junction
ssc04923  Regulation of lipolysis in adipocytes
ssc04924  Renin secretion
ssc04970  Salivary secretion
ssc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    397355 (ADRB1)
   04024 cAMP signaling pathway
    397355 (ADRB1)
   04022 cGMP-PKG signaling pathway
    397355 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397355 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    397355 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    397355 (ADRB1)
   04924 Renin secretion
    397355 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397355 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    397355 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    397355 (ADRB1)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    397355 (ADRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4 DUF5476
Motif
Other DBs
NCBI-GeneID: 397355
NCBI-ProteinID: NP_001116546
Ensembl: ENSSSCG00000010647
UniProt: Q28998
Position
14
AA seq 468 aa AA seqDB search
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVPASPPASLLTPASEGSVQLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRAARALVCT
VWAISALVSFLPILMHWWRDKGAEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMA
FVYLRVFREAQKQVKKIDSCERRFLGSPARPPSPAPSPGSPLPAAAAAAPVANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRVARGSCAAAGDGPRASGCLAVARPPPSPGAASDD
DDDEEDVGAAPPAPLLEPWAGYNGGAARDSDSSLDERTPGGRASESKV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgccctgggtgcctccgagccctgcaacctgtcatcggccgcg
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcctgcgtcccctcccgcc
tcgctgctgaccccagccagcgagggatccgtgcagctgtcgcagcagtggacggctggc
atgggcctcctgatggcgctcatcgtgctgctcatcgtggcgggcaacgtgctggtgatc
gtggccatcgccaagacgccgaggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccattcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctctggacgtcggtggacgtactg
tgcgtgacggccagtatcgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acgtcgccctttcgctaccagagcctgctgacccgcgcggcacgggccctcgtgtgcacc
gtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgggac
aagggtgccgaggcacgccgctgctacaacgaccccaagtgctgcgatttcgtcaccaac
agggcctacgccatcgcctcgtccgtggtctccttctacgtgcccttgtgcatcatggcc
ttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagctgc
gagcgccgctttctcggcagccccgcgcggccgccctcgcccgcgccctcgcccgggtcc
ccgctccctgccgccgctgccgcagccccggtagccaacgggcgcaccagcaagaggcgg
ccctcgcgcctcgtggccctgcgagagcagaaggcgctcaagacgctgggcatcatcatg
ggcgtgttcacgctctgctggctacccttcttcctggccaacgtggtgaaggccttccac
cgcgacctggtgcccgaccgcctcttcgtcttcttcaactggctgggctacgccaactcg
gccttcaaccccatcatctactgccgcagccctgacttccgcaaggccttccagcgcctg
ctctgctgcgcgcgccgggtcgcccgcgggagctgcgcggccgccggggatgggccgcgc
gcctctggctgcctggcggtggcccggccgccgccgtcgcccggggccgcctcggacgac
gacgacgacgaagaagacgtcggggccgcgccgccggcgcccctgctggagccctgggcc
ggatataacggcggggcggcacgtgacagcgactcgagcctggacgagcggacgcccggg
ggccgcgcctcggaatccaaggtgtag

DBGET integrated database retrieval system