KEGG   Sus scrofa (pig): 397398Help
Entry
397398            CDS       T01009                                 

Gene name
DNASE2
Definition
(RefSeq) deoxyribonuclease-2-alpha precursor
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    397398 (DNASE2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     397398 (DNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 397398
NCBI-ProteinID: NP_999361
Ensembl: ENSSSCG00000013731
UniProt: O62855 A0A480E0K4
Position
2
AA seq 364 aa AA seqDB search
MATLSPLLLAALLWVPVGTLTCYGDSGQPVDWFVVYKLPAHSSPGDVAQSGLRYKYLDEE
SGGWRDGAGSINSSTGALGRSLLPLYRNTSQLAFLLYNDQPPKYRGSQHSSNRGHTKGVL
LLDQEGGFWLIHSVPNFPPPSSSAAYSWPPSARTYGQTLICVSFPLTQFLNISRQLTYTY
PMVYDYKLEGDFARKFPYLEEVVKGHHVLQEPWNSSVTLTSKAGASFQSFAKCGNFGDDL
YSGWLAEALGSNLQVQFWQRSAGILPSNCSGVQHVLDVTQIAFPGPAGPNFNATEDHSKW
CVAPERPWTCVGDMNRNKREEHRGGGTLCAQLPALWKAFKPLVKAWEPCEKENRAFSPRS
PAKD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgagccccctgctattggccgcgctgctctgggtccctgtggggaccctg
acctgctacggagactcggggcagcctgtggactggttcgttgtctacaagctgccggcc
cacagcagtcccggagatgtggctcagagcgggctccggtacaagtacttggacgaggag
tcaggaggctggcgcgacggcgcggggtccatcaacagctccacaggcgccttgggccgc
agcctgctgccgctgtaccgaaacaccagccagctagctttcctgctctacaatgatcaa
ccgcctaaatacagaggatctcagcactcttccaaccgtgggcacacgaagggtgtactg
ctcctggaccaagaagggggcttctggctaatccacagcgttccaaacttccctccacct
tcctcctctgctgcatacagctggcctcctagcgcccgaacctatgggcagacactgatc
tgcgtatctttccctctcacccagttcctgaatatcagcagacagctgacctacacctac
cccatggtgtatgattacaagctggagggagacttcgccaggaaattcccctacctggag
gaggtagtcaagggccatcatgttctccaggaaccctggaacagcagtgtaacactcaca
tcaaaagcaggggcctcattccagagctttgctaagtgtggaaactttggagacgacctg
tactctggctggttggcagaagcccttggcagcaacctgcaggtccaattctggcaaaga
tctgctggaatcctgccctccaactgctctggggtccagcacgtgctggatgtgacccag
atagcctttcctggcccagcggggccaaacttcaatgccacagaagaccactccaagtgg
tgtgtagccccagaaaggccctggacctgtgtgggtgacatgaatcggaacaaaagagag
gagcatcggggtgggggcacactgtgtgcccagctgcctgcactctggaaggccttcaag
cctctggtgaaggcctgggagccctgtgagaaggagaacagggccttctctccaagaagc
ccagcaaaggattaa

DBGET integrated database retrieval system