KEGG   Sus scrofa (pig): 397401Help
Entry
397401            CDS       T01009                                 

Gene name
RAMP1
Definition
(RefSeq) receptor activity-modifying protein 1 precursor
  KO
K08447  receptor activity modifying protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    397401 (RAMP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    397401 (RAMP1)
G protein-coupled receptors [BR:ssc04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    397401 (RAMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAMP
Motif
Other DBs
NCBI-GeneID: 397401
NCBI-ProteinID: NP_999364
UniProt: Q867C0
Position
15
AA seq 148 aa AA seqDB search
MARGLRGLPRRGLWLLLVNHLFLATACQDTDHAALLRKYCLPQFQVDMEAIGKALWCDWD
KTIGSYKDLSDCTRLVAQRLDCFWPNAAVDKFFLGVHQQYFRNCPVSGRALQDPPSSVLC
PFIVVPILATLLMTALVVWRSKRPEGIV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggcctgcgcggcctcccgcggcgcggcctctggctgctgctggtgaatcac
ctcttcttggccaccgcctgccaggacactgaccacgccgccctcctccggaagtactgc
ctcccccagttccaggtggacatggaggccatcgggaaggcgctgtggtgcgactgggac
aagaccatcgggagctataaagacctctcagactgcaccaggctcgtggcgcaaaggctg
gactgcttctggcccaacgcggcggtggacaagttcttcctgggagtccaccagcagtac
ttcagaaactgccccgtctccggcagggccttgcaggacccgcccagcagcgtcctctgc
cccttcatcgtcgtccccatcctggcgaccctgctcatgaccgccctggtggtctggagg
agcaagcgccccgagggcatcgtgtaa

DBGET integrated database retrieval system