KEGG   Sus scrofa (pig): 397418Help
Entry
397418            CDS       T01009                                 

Gene name
UBA52
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  large subunit ribosomal protein L40e
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    397418 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssc03011]
    397418 (UBA52)
Ribosome [BR:ssc03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    397418 (UBA52)
  Archaea
    397418 (UBA52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 397418
NCBI-ProteinID: NP_999376
Ensembl: ENSSSCG00000013907
UniProt: P63053
Position
2
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctgacgggcaagaccatcacccttgaggtcgagcccagt
gataccattgagaatgtcaaagctaaaatccaggataaggagggcatcccacctgaccag
cagcgtctgatttttgctggcaaacagctggaggatggccgcactctctcagactacaat
atccagaaagagtccaccctgcacttggtgcttcgtctgcgaggtggcatcatcgagccc
tccctccgccagctcgctcagaaatacaactgcgacaagatgatctgccgcaagtgttat
gctcgcctgcatccccgcgcggtgaactgccgcaagaagaagtgtggccacaccaacaac
ctgcgccccaagaagaaggtcaaataa

DBGET integrated database retrieval system