KEGG   Sus scrofa (pig): 397419
Entry
397419            CDS       T01009                                 

Gene name
TTR
Definition
(RefSeq) transthyretin precursor
  KO
K20731  transthyretin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    397419 (TTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397419 (TTR)
Transporters [BR:ssc02000]
 Other transporters
  Others
   397419 (TTR)
SSDB
Motif
Pfam: Transthyretin
Other DBs
NCBI-GeneID: 397419
NCBI-ProteinID: NP_999377
Ensembl: ENSSSCG00000023686
UniProt: P50390
Position
6
AA seq 150 aa
MASYRLLLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGT
WEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDS
GRRHYTIAALLSPYSYSTTALVSSPKEGAL
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcttcttaccgtctgctcctcctttgcctcgctggactggtgtttgtgtctgaggct
ggccctgcgggtgctggtgaatccaagtgtcctctgatggtcaaagtcctggatgctgtc
cgaggcagtccggccgtgaacgtaggcgtgaaagtgttcaaaaaggctgctgatgggact
tgggagccctttgccttggggaaaaccagtgaatttggagagctccatgggctcacaaca
gatgagaaatttgtagaaggcatatacaaagtggaattggacaccaaatcctactggaag
gcacttggcatttccccattccatgaatatgcagaggttgtgttcacagccaacgactcc
ggccgacgccactacaccatcgctgccctgcttagcccctactcttactccaccacagcc
ctcgtcagcagccccaaggagggagctctttga

DBGET integrated database retrieval system