KEGG   Sus scrofa (pig): 397438
Entry
397438            CDS       T01009                                 

Gene name
OTC
Definition
(RefSeq) ornithine carbamoyltransferase, mitochondrial
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00220  Arginine biosynthesis
ssc01100  Metabolic pathways
ssc01230  Biosynthesis of amino acids
Module
ssc_M00029  Urea cycle
ssc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    397438 (OTC)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     397438 (OTC)
SSDB
Motif
Pfam: OTCace OTCace_N
Other DBs
NCBI-GeneID: 397438
NCBI-ProteinID: NP_001157474
Ensembl: ENSSSCG00000012236
Vega: OTTSUSG00000004488
UniProt: A0A480E1W6 A0A4X1U355
Position
X
AA seq 354 aa
MLFNLRILLNKSALRHSHNCVVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYILWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLKDTARVLSSMTDAVLARVYKQSDLDILAQEASIPIINGLSDLYHPIQILADYLTLQ
EHYGALKGLTLSWIGDGNNILHSIMMSAAKFGMHLQVATPKGYEPDPSITKLAEQYAKEN
GTKLSLTNDPLEAARGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAEVAASDWTF
LHCLPRKPEEVDDEVFYSPQSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgtttaatttgaggattctgttgaacaagtcagcccttagacacagtcacaattgc
gtggtgcgaaattttcgatgtggacaaccactacaaaataaagtgcagctgaagggtcgt
gacctcctcactctaaagaactttacaggagaagaaattaagtatatcctatggctatca
gctgatctgaaatttaggataaagcagaaaggagagtatttgcctttattgcaagggaag
tccctcggcatgatttttgaaaaaagaagtactcgaacaagattgtctacagaaacaggc
tttgcccttctaggaggacacccttgttttcttaccacacaagatattcacttgggtgtg
aatgaaagtctcaaggacaccgctcgtgtgttgtctagcatgacagatgcagtgttggcg
cgagtgtataaacaatcagacctggacatcctggctcaagaagcatccatcccaatcatc
aatgggctgtcagatttgtaccatcctatccagatcctggctgattacctcacgctccag
gaacactacggcgctctgaaaggccttaccctcagctggattggggatgggaataacatc
ctgcactccatcatgatgagtgcggcgaaatttgggatgcaccttcaggtggcgactcca
aagggctatgagccggatcccagtataaccaagttggcggagcagtatgccaaggagaac
gggaccaagctgtcgctgacgaatgatccattggaggcggctcgtggaggcaatgtatta
attacagacacttggataagcatgggacaagaagaggagaagaaaaagcggctccaggct
ttccaaggttaccaggttacaatgaagactgcggaagttgctgcctctgactggacattt
ttacactgcctgcccagaaagccagaagaagtggacgatgaagtgttttactctccacaa
tcacttgtattcccggaggctgaaaacagaaagtggacaatcatggctgtcatggtgtct
ctgctgacagattactcgcctcagctccagaagccgaagttttga

DBGET integrated database retrieval system