KEGG   Sus scrofa (pig): 397442Help
Entry
397442            CDS       T01009                                 

Gene name
THOP1
Definition
(RefSeq) thimet oligopeptidase
  KO
K01392  thimet oligopeptidase [EC:3.4.24.15]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04614  Renin-angiotensin system
ssc05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    397442 (THOP1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    397442 (THOP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397442 (THOP1)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.15  thimet oligopeptidase
     397442 (THOP1)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M3
   397442 (THOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 397442
NCBI-ProteinID: NP_999388
Ensembl: ENSSSCG00000013468
UniProt: P47788
Position
2
AA seq 687 aa AA seqDB search
MKPPAACAGDALDVAAPCSAVNYLRWDLSAQQIGELTTELIEQTKRVYDRVGTQELQDVS
YENTLKALADVEVSYTVQRNILDFPQHVSPCKDIRTASTEADKKLSEFDVEMSMRQDVYQ
RIVWLQEKVQKDSLRPEAARYLERLIKLGRRNGLHLPKETQEKIKSIKKKLSLLCIDFNK
NLNEDTTFLPVTREELGGLPEDFLNSLEKTEDEKLKVTLKYPHYFPLLKKCHVPETRRKV
EEAFNCRCKEENCAILRELVRLRAQKSSLLGFSTHADYVLEMNMAKTSQVVATFLDELAQ
KLKPLGEQERAVILELKKAECTKRGLDFDGRINAWDMRYYMNQVEETRYRVDQNLLKEYF
PMQVVTRGLLGIYQELLGLTFHLEEGAAVWHEDVMLYSVRDAASGKVIGKFYLDLYPREG
KYGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTPDAPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEAEPLLRMSQHYRTGSAIPQELLEKLI
KSRQANTGLFNLRQIVLAKVDQALHTQTAADPAEEYARLCQEILGVPATPGTNMPATFGH
LAGGYDAQYYGYLWSEVYSADMFHTRFKQEGILSGKVGMDYRSCILRPGGSEDASVMLKL
FLGRDPKQDAFLLSKGLQVEGCEPPAS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccccagcagcctgtgcaggagatgccctggatgtggcggcgccatgctctgct
gtgaactacctccggtgggacctgagcgcccagcagattggggagctcaccacagaactc
atcgagcagacaaagcgtgtgtacgaccgcgtgggcacccaggagcttcaggatgtatcc
tacgagaacacgctcaaggcactggctgacgtggaagtgtcctacacagttcagaggaac
atccttgacttcccccagcacgtgtctccatgcaaggacatccgcacggccagcacggag
gcggacaagaagctgtccgagtttgatgtggagatgagcatgaggcaggatgtgtaccag
aggatcgtctggctgcaggagaaggtccagaaggactcactgaggccagaggcggcacgg
tacctggagcggctgatcaaactgggccggagaaatgggctccacctgcccaaggaaacg
caggagaaaattaagagcatcaaaaagaagctaagcctcctgtgcatcgacttcaacaag
aacctgaacgaagacacgacctttctgccggttacacgagaggagctgggagggctcccc
gaggactttctcaactcgctagagaagacggaggatgagaagctgaaggttaccctcaag
tacccacactacttcccccttctgaagaagtgccatgtgccagagaccaggaggaaggtg
gaggaagccttcaactgtcggtgcaaggaggagaactgtgcgatcctccgggagctggtg
aggctgcgggcgcagaaatccagcctgttggggttcagcacccatgctgactacgtgctg
gagatgaacatggccaagaccagccaggtggtggccactttcctagatgagctggcccag
aagctgaagccccttggggagcaggagcgggctgtgatcctggagctgaagaaggccgag
tgcaccaagcggggccttgactttgatggccgcatcaacgcctgggacatgcgctactac
atgaaccaagtggaggagacacgctaccgtgtggaccagaacctgctcaaggagtacttc
cccatgcaggtggtcacccgtgggctcctgggcatctaccaggagctgctggggctgacc
ttccacctggaggagggcgccgctgtgtggcatgaggatgtgatgctgtattctgtcagg
gatgcagcctcaggcaaagtcatcgggaagttctacctggacctctacccgagggaaggg
aagtacgggcacgcagcctgctttggcctgcagccaggctgcctgcggcaggacgggagc
cgccagatcgccatcgcagccatggtggccaacttcaccaagcccacgcctgacgcgccc
tccctgctgcagcacgatgaggtggagacctacttccatgagtttgggcatgtgatgcac
cagctatgctcccaggccgagttcgccatgttcagtgggacacacgtggagcgggacttc
gtggaggcaccctcgcagatgctggagaactgggtgtgggaggcagagccgctgctcagg
atgtcccagcactaccggacgggcagcgctatcccgcaggagctgctggagaagctcatc
aagtcccggcaggccaacacaggcctcttcaacctgcgccagatcgtcctggccaaggta
gaccaggccctgcacacgcagacggccgcagacccggctgaggagtacgcccgactctgc
caggagatccttggggtcccagccacaccagggaccaacatgcctgcgacctttggccac
ctggcggggggctacgatgcccagtactacggctacttgtggagtgaggtgtactccgcg
gacatgttccacacgcgcttcaagcaggagggcatcctgagtggcaaggtgggcatggac
tacagaagctgtatcctgagacctggcggctccgaggatgccagcgtcatgttgaagctc
ttcctgggtcgggatcccaagcaggatgccttcctcctgagcaaaggactgcaggttgaa
ggctgcgagccaccagcttcttga

DBGET integrated database retrieval system