KEGG   Sus scrofa (pig): 397444Help
Entry
397444            CDS       T01009                                 

Gene name
GNMT
Definition
(RefSeq) glycine N-methyltransferase
  KO
K00552  glycine N-methyltransferase [EC:2.1.1.20]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00260  Glycine, serine and threonine metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    397444 (GNMT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.20  glycine N-methyltransferase
     397444 (GNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 Methyltransf_23 TehB Ubie_methyltran MTS PCMT TPMT Methyltransf_15 CMAS
Motif
Other DBs
NCBI-GeneID: 397444
NCBI-ProteinID: NP_001103889
Ensembl: ENSSSCG00000001652
UniProt: Q29555
Position
7
AA seq 295 aa AA seqDB search
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQR
VLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMT
LDKDVPKSPMGGFDAVICLGNSFAHLPDCRGDQSEHRLALKNITSMVRSGGLLVIDHRNY
DHILSTGCAPPGKNIYYKSDLIKDITTSVLTVNNKAHMVTLDYTVQVPGTGHRGSPGLSK
FRLSYYPHCLASFTELLQTAFGGKCQHSVLGDFKPYKPGQAYIPCYFIHVLRKTD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtggacagcgtgtaccggacccgctccctgggggtggcggctgaagggctcccggac
cagtacgcggacggagaggcggcgcgcgtgtggcagctgtacatcggagacacccgcagc
cgcacggctgagtacaaggcttggctgctcggactgctgcgacagcacggctgccagcga
gtcctcgacgtggcctgtggtaccggggtggactccatcatgctagtggaagaaggcttc
agtgtgacaagtgtggatgccagtgacaagatgctcaagtatgcacttaaagagcgctgg
aaccggcggcatgagcctgctttcgacaagtgggtcattgaagaagccaactggatgact
ctagacaaagatgtgcccaagtcaccaatgggtggcttcgatgctgtcatctgccttgga
aacagttttgcccacttgccagactgcagaggggaccagagtgagcaccggctggccctg
aaaaacatcacaagcatggtgcggtcagggggcttgctggtcattgatcatcgaaactac
gaccacatcctcagcacaggctgtgcacccccaggaaagaacatctactataagagtgac
ctgatcaaggacatcacgacatctgtgctgacagtgaacaacaaggctcacatggtgacc
ctcgattacacggtgcaggtgccggggactggccacagaggttctcctggcttgagtaag
ttccggctctcctactaccctcactgtctggcatcctttacggagctgctacaaacagcc
ttcgggggcaagtgccagcacagtgtcctaggagatttcaagccttacaagccgggccag
gcctacattccctgctatttcatccacgtgctcaggaagacggactga

DBGET integrated database retrieval system