KEGG   Sus scrofa (pig): 397457
Entry
397457            CDS       T01009                                 

Symbol
EDNRA
Name
(RefSeq) endothelin-1 receptor precursor
  KO
K04197  endothelin receptor type A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04270  Vascular smooth muscle contraction
ssc04924  Renin secretion
ssc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    397457 (EDNRA)
   04024 cAMP signaling pathway
    397457 (EDNRA)
   04022 cGMP-PKG signaling pathway
    397457 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397457 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    397457 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    397457 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397457 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    397457 (EDNRA)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Peptide
   Endothelin
    397457 (EDNRA)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 397457
NCBI-ProteinID: NP_999394
Ensembl: ENSSSCG00000009031
UniProt: Q29010
Position
8
AA seq 427 aa
METFCFRVSFWVALLGCVISDNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERS
SHKDSIN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccttctgcttcagggtgtccttttgggtggccctgttgggatgcgtaatcagt
gataaccctgagagccacagcacaaatctgagcactcacgtggacgatttcaccacattt
cgtggaacagaattcagtttggtggttaccactcatcgacccacgaatctggccctcccc
agcaatggctccatgcacaactactgcccacagcagaccaagattacttcagctttcaaa
tacattaacactgtgatatcgtgtactattttcatcgtgggaatggtggggaatgcaacc
ctgctcaggatcatttaccagaacaagtgcatgaggaacggccccaacgcgctgatagcc
agccttgcccttggagacctcatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccctttgagaaccatgactttggcgtatttctctgcaagttg
ttcccctttttgcagaagtcctcagtggggatcaccgtcctcaatctctgcgctctcagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaatcgggattccattg
gtcacagccattgagattgtctccatctggatcctttcttttatcctggccatccctgaa
gcaatcggctttgtcatggtgccctttgaatacaagggcgaagagcacaaaacctgtatg
ctcaatgccacgtcaaaattcatggagttctatcaagacgtaaaagactggtggctgttc
gggttctacttctgcatgcccctggtgtgtactgccatcttctacactctcatgacttgt
gagatgttaaacagaagaaatggaagcctgagaattgccctcagtgaacacctgaaacag
cgtcgagaggtggcaaaaacagtgttctgcctggttgtaattttcgctctgtgctggttc
cctcttcatttaagccgtattttgaagaaaaccgtgtatgatgagatggacaagaaccga
tgtgaattacttagtttcctgctcctcatggactatattggtattaacttggcaaccatg
aactcatgtataaacccaatagctctatattttgtgagcaagaaatttaaaaattgtttc
cagtcttgcctctgctgctgctgttaccagtccaaaagtctgatgacctcagtccccatg
aatggaacaagcatccagtggaagaaccatgaacaaaacaaccataacactgagaggagc
agccacaaggacagtataaactaa

DBGET integrated database retrieval system