KEGG   Sus scrofa (pig): 397462Help
Entry
397462            CDS       T01009                                 

Gene name
AVPR2
Definition
(RefSeq) vasopressin V2 receptor
  KO
K04228  arginine vasopressin receptor 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04072  Phospholipase D signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    397462 (AVPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397462 (AVPR2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    397462 (AVPR2)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Peptide
   Vasopressin
    397462 (AVPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Git3
Motif
Other DBs
NCBI-GeneID: 397462
NCBI-ProteinID: NP_999397
Ensembl: ENSSSCG00000012789
Vega: OTTSUSG00000004942
UniProt: P32307
Position
X
AA seq 370 aa AA seqDB search
MLRATTSAVPRALSWPAAPGNGSEREPLDDRDPLLARVELALLSTVFVAVALSNGLVLGA
LVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATYRFRGPDALCRAVKYLQMV
GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQR
DVGDGSGVLDCWASFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLVPGPA
ERAGGHRGGRRAGSPREGARVSAAMAKTARMTLVIVAVYVLCWAPFFLVQLWSVWDPKAP
REGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATA
SSFSARDTSS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagccaccacctcggctgtgccccgggccctctcgtggcccgccgcacccggc
aacggcagcgagagggagccgctggacgaccgggacccgctgctggcccgggtggagctg
gccctgctgtccacggtctttgtggccgtggccctgagcaatggcttggtcctgggggcc
ctggtgcggcggggccggcggggccgctgggcgcccatgcacgtcttcatcggccacttg
tgtctggccgacctggccgtggctctgttccaagtgctgccccagctggcctgggatgcc
acctaccgcttccgtgggcctgatgccctgtgccgggcggtcaagtacctgcagatggta
ggcatgtacgcctcctcctacatgatcctggccatgacgctggaccgccaccgcgccatc
tgccgccccatgctggcataccgccacggaggtggagctcgctggaaccggccggtgctg
gtggcctgggccttctcgctgcttctcagcctgccccagctcttcatctttgcccagcgc
gacgtgggagacggcagcggggtcctcgactgctgggccagctttgccgagccctggggc
ctgcgtgcctacgtcacgtggatcgccctgatggtgtttgtggcgcctgccttgggcatc
gccgcctgccaggtgctcatcttccgggagattcacaccagcctggtcccggggccggcg
gagagggctggggggcaccgcggggggcgccgggcgggcagcccccgcgagggagcccgg
gtgtcggcggccatggctaagacggcgaggatgacgctggtgatcgtggctgtgtacgtg
ctgtgctgggcgcccttcttcctcgtgcagctctggtccgtgtgggacccgaaggcgcct
cgggaagggcccccttttgtgctgctcatgctgctggccagcctcaacagctgtaccaac
ccctggatctacgcctccttcagcagcagcatctcctcggagctgcggagcctgctctgc
tgcccccggaggcgcaccccgcccagcctcaggccccaagaggagtcctgcgccaccgcc
agctccttctcggccagggacacctcgtcctga

DBGET integrated database retrieval system