KEGG   Sus scrofa (pig): 397468Help
Entry
397468            CDS       T01009                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin precursor
  KO
K05226  cholecystokinin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04911  Insulin secretion
ssc04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397468 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    397468 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    397468 (CCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gastrin Gln_amidase
Motif
Other DBs
NCBI-GeneID: 397468
NCBI-ProteinID: NP_999402
Ensembl: ENSSSCG00000011277
UniProt: P01356
Position
13
AA seq 114 aa AA seqDB search
MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL
LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggcttgtgcctgtgtgtgctgatggcggtcctggcggcaggcaccctggcg
cagccggtgcctcccgcggactccgcggtccccggggcacaggaggaggaggcgcaccgg
cggcagctgagggcggtgcaaaaggtagacggcgagtcccgagcgcacctgggcgcgctg
ctggccagatacatccagcaggctcgaaaagcaccttctggccgagtatctatgattaag
aatctgcagagcctggaccccagccacagaataagtgaccgggactacatgggctggatg
gattttggccggcgcagtgcagaggagtatgaatatacctcctag

DBGET integrated database retrieval system