KEGG   Sus scrofa (pig): 397496Help
Entry
397496            CDS       T01009                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A precursor
  KO
K12334  natriuretic peptide A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04714  Thermogenesis
ssc04921  Oxytocin signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04924  Renin secretion
ssc04925  Aldosterone synthesis and secretion
ssc05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    397496 (NPPA)
   04024 cAMP signaling pathway
    397496 (NPPA)
   04022 cGMP-PKG signaling pathway
    397496 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    397496 (NPPA)
   04921 Oxytocin signaling pathway
    397496 (NPPA)
   04924 Renin secretion
    397496 (NPPA)
   04925 Aldosterone synthesis and secretion
    397496 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    397496 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    397496 (NPPA)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05143 African trypanosomiasis
    397496 (NPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANP
Motif
Other DBs
NCBI-GeneID: 397496
NCBI-ProteinID: NP_999425
UniProt: P24259
Position
6
AA seq 150 aa AA seqDB search
MSSFTITVSFLLVLVFQFPGQTRANPVYGSVSNADLMDFKNLLDHLEDKMPLEDEAMPPQ
VLSEQNEEVGAPLSPLLEVPPWTGEVNPAQRDGGALGRGPWDASDRSALLKSKLRALLAA
PRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagctccttcaccatcaccgtgagcttcctcctcgttctggtgtttcagttcccaggg
caaaccagagcgaaccctgtgtacggctccgtgtccaatgcagacctgatggatttcaag
aatttgctggaccacttggaggacaagatgcctttagaagatgaggctatgcccccacaa
gtactaagcgagcagaatgaggaagtgggggcccctctcagcccccttttggaggtacct
ccctggaccggggaggtgaacccagcccagagagatgggggtgccctggggcggggcccc
tgggacgcttccgatagatctgcccttctgaagagcaagctgagggcactgcttgctgcc
cctcggagcctgcggaggtccagctgcttcgggggtaggatggacaggattggagcacag
agtggactgggctgtaacagcttccggtactga

DBGET integrated database retrieval system