KEGG   Sus scrofa (pig): 397532
Entry
397532            CDS       T01009                                 

Gene name
COL5A2
Definition
(RefSeq) collagen alpha-2(V) chain precursor
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    397532 (COL5A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397532 (COL5A2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   397532 (COL5A2)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa Amnionless
Other DBs
NCBI-GeneID: 397532
NCBI-ProteinID: NP_001098759
UniProt: Q59IP2
Position
15
AA seq 1499 aa
MMANWAEARPLLILTVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIQCQDVLECADPITPPGECCPVCPHTTGGGNTNIGRGRKGQKGEPGL
VPIVTGIRGRPGPAGPPGSQGPRGERGPKGKPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPMGPPG
EPGEPGPMGPIGARGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGATGSKGEAGPTGPMGAMGPMGPRGMPGERGRLGPQGAPGQRGAHG
MPGKPGPMGPLGIPGSPGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSQGLPG
AVGTDGTPGAKGPTGSPGTSGPPGLAGPPGSPGPQGSTGPPGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPTGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGAPGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SRGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLLGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPVGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSA
EDAIKVYCNMETGETCISANPYSIPRKMWWASKSPDYKPVWYGLDMNRGSQFVYGDHQSP
NAAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGSNDLEIKAEGNVR
FRYTVLHDTCSKRNGNVGKTIFEYRTQNVARLPIIDLAPVDVGSTDQEFGVEIGPVCFV
NT seq 4500 nt   +upstreamnt  +downstreamnt
atgatggcaaactgggcagaagcaagacctctcctcattcttactgttttattagggcaa
tttgtctcaataaaagcccaggaagaagacgaggatgaaggatatggtgaagaaatagcc
tgcactcagaatggtcagatgtacttaaacagggacatttggaaacctgccccttgccag
atctgtgtctgtgacaatggtgccattctttgtgacaagatacagtgccaggatgtgctt
gaatgtgctgaccccataactccccctggggaatgctgtcctgtctgtccgcatacaact
ggaggtggcaataccaatattggtagaggaagaaagggacaaaaaggagaaccaggatta
gtgcctattgtaacaggcatacgtggacgtccaggacctgcaggacctccaggatctcaa
ggaccaaggggagagagaggcccaaaaggaaaacctggtccgcgtggtcctcagggaatt
gatggagaaccaggtgttcctggtcaaccaggtgccccaggacctcctggacatccgtct
cacccaggaccagatggcatgagcagaccattttcagctcagatggctgggttggatgaa
aaatctggacttgggagtcaagtaggactgatgcctggctctgtgggtcctgttggccca
aggggacctcaaggtttacaggggcagcaaggtggtgctggccctatgggacctcctggt
gaacctggtgaacctggaccaatgggtccaattggtgcacgtggaccagagggcccccct
ggaaaacctggtgaagatggtgagccgggtagaaatggaaatcctggtgaagtgggattt
gcaggatctccgggagctcgaggatttcctggggctcctggtcttccaggcctgaagggt
caccgaggacacaaaggtcttgagggccctaaaggtgaagttggagcaactggttccaag
ggtgaagctggccctactggtccaatgggtgctatgggtcctatgggtccaagagggatg
ccaggagagagagggagacttgggccacagggtgctcctggacaacgaggtgcacatggt
atgcctggaaaacctgggccaatgggtcctcttgggatacctggctcccctggttttcca
ggaaatcctggaatgaagggagaagcaggtcccactggggcacgaggccctgaaggtcct
caggggcaaagaggtgaaactgggccaccaggtcccgttggctctcaaggtcttcctggt
gcagtgggaactgatggtacacctggtgccaaaggcccaacgggttctccaggtacttct
ggtcctcctggcttagcaggcccccctggatctccaggaccacagggtagtactggacct
ccaggaattcgaggccaaccgggtgatccaggagttccaggtttcaaaggagaagctggc
ccaaaaggggaaccagggccacatggtattcagggaccaataggcccacctggtgaagaa
ggcaaaagaggtcctcgtggtgatccaggaacagtcggtcctccaggcccgatgggagaa
aggggtgctcctggcaatcgtggttttccaggctctgatggtttacctggaccaaagggg
gctcaaggagagagaggtcctgtaggttcttcaggacctaaaggaggtcagggggatcca
ggacgtccaggcgaacctgggcttccaggtgctcggggtctgacaggaaatcctggtgtt
caaggtcctgaaggaaaacttggacctttgggtgctccaggggaggatggccggccaggg
cctccaggctccataggaatcagagggcagcctgggagtatgggtcttccaggccccaaa
ggtagcagtggtgaccctggaaaacctggagaagcaggaaatgctggtgttcctgggcag
aggggagctcctggaaaagatggcgaagtcggtccttctggacctgtgggtccgccgggt
ctagctggggagagaggagaacagggccctccaggccccactggctttcaggggcttcct
ggtcctccagggcctcctggggaaggtggaaaaccaggtgatcagggtgttcctggagat
cctggagcagttggcccattaggacctagaggagaacgaggaaatccaggggaaagagga
gaaccaggaataactggacttcctggtgagaagggaatggctggaggacatggtcctgat
ggcccaaaaggcagtccaggaccaagtgggacccctggagatacaggcccaccaggtctt
caaggtatgccaggagaaagaggaattgcaggaactcctggccccaagggtgacagagga
ggcataggagagaaaggtgctgaaggcacagctggaaatgatggagcgagaggtcttcca
ggtcccttgggtcctccaggtcctgcaggtcccaccggagaaaagggtgaacctggccct
cgaggtttagttggcccacctggctcccgtggcaatcctggttctcgtggtgaaaatggc
ccaactggagctgttggttttgctggaccccagggtcctgatgggcagcctggagtaaaa
ggtgaacctggagagccaggacagaagggagatgctgggtctcctggaccacaaggtcta
gcaggatccccaggccctcatggtcctaatggtgttcctggactgaaaggtggtcgagga
actcagggtcctcctggtgctacaggatttcctggttctgctggcagagttggaccccca
ggtcctactggagctccaggacctgcagggcccttaggggaacctgggaaggagggacct
ccaggtcttcgtggagaccccggctctcacgggcgagtgggagatagaggaccagctggc
cctcctggtggcccaggagacaaaggggacccaggagaagatgggcaacctggtccagat
ggtcccccgggtccagctggaactactgggcaaagaggaatcgtcggcatgcccgggcag
cgtggagagcgagggatgcctggccttccaggcccagcaggcacaccaggaaaagtagga
ccgactggtgcaccaggagataaaggcccccctggacctgtgggacccccaggctcaaat
ggccctgtgggagaaccaggacctgagggtccagctggtaatgacggtactccgggacgg
gatggtgctgttggagaacgtggtgatcgcggagaccctgggcctgcaggtctgccgggc
tctcggggtgcccctggaacccccggccctgttggtgccccaggagatgcaggacaaaga
ggagacccgggttctcggggtcctataggaccacctggtcgagccgggaaacgtggctta
cttggaccccaaggacctcgcggtgacaaaggggatcatggtgaccgaggtgaccgaggt
cagaagggtcacagaggcttcactggtcttcaaggtcttcctggacctcccggtcccaat
ggtgaacaaggcagtgctggaatccctgggccatttggcccaagaggtcctccaggccct
gttggtccttcggggaaagagggaaaccctgggccgcttgggccagtcggacctcctggt
gtgcgaggcagtgttggagaagccggccccgagggtcctcctggtgagcctggtccacct
ggccctccgggtccccctggccaccttacagctgctcttggggatatcatggggcactat
gatgagagcatgccagatccacttccagagtttactgaagatcaggcggctcctgatgac
aaaaacaaaactgacccaggggtccatgctactctgaagtcactcagtagtcagattgaa
accatgcgcagccctgatggctctaaaaaacaccctgcccggacttgtgatgacttaaag
ctttgccattctgcaaagcagagcggtgagtactggattgatcctaaccagggatctgct
gaagatgcaatcaaagtttactgcaacatggaaacaggagaaacgtgtatttcggcaaac
ccatacagtataccacggaaaatgtggtgggccagcaaatctcctgattataagcctgtt
tggtatggtcttgacatgaatagaggatctcagtttgtttatggagaccaccagtcacct
aatgcagccattactcaaatgaccttcttgcgacttttatcaaaagaagcctcccagaac
attacttacatctgtaaaaacagtgtaggatacatggatgatcaggctaagaacctcaag
aaagctgtggttctgaaagggtcaaatgacttagaaatcaaagcagagggaaatgttaga
ttcagatacaccgttcttcacgatacttgctctaaacgaaatggaaacgtgggcaagacc
atctttgaatatagaacacagaatgtggcacgcttgcccatcatagatcttgcccctgtg
gatgttggcagtacagaccaagaatttggcgtcgaaattgggccagtttgttttgtgtaa

DBGET integrated database retrieval system