KEGG   Sus scrofa (pig): 397557Help
Entry
397557            CDS       T01009                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00220  Arginine biosynthesis
ssc00330  Arginine and proline metabolism
ssc01100  Metabolic pathways
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04611  Platelet activation
ssc04915  Estrogen signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04931  Insulin resistance
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    397557 (NOS3)
   00330 Arginine and proline metabolism
    397557 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    397557 (NOS3)
   04371 Apelin signaling pathway
    397557 (NOS3)
   04066 HIF-1 signaling pathway
    397557 (NOS3)
   04020 Calcium signaling pathway
    397557 (NOS3)
   04071 Sphingolipid signaling pathway
    397557 (NOS3)
   04022 cGMP-PKG signaling pathway
    397557 (NOS3)
   04151 PI3K-Akt signaling pathway
    397557 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    397557 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    397557 (NOS3)
   04921 Oxytocin signaling pathway
    397557 (NOS3)
   04926 Relaxin signaling pathway
    397557 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    397557 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    397557 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    397557 (NOS3)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     397557 (NOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 397557
NCBI-ProteinID: NP_999460
Ensembl: ENSSSCG00000016450
UniProt: Q28969
Position
18
AA seq 1205 aa AA seqDB search
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPAPATPHAPEHSPAPNSPT
LTRPPEGPKFPRVKNWEVGSITYDTLCAQSQQDGPCTPRRCLGSLVLPRKLQSRPSPGPP
PAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVATTGTYHLGESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRTPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
PPELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSAAKGTGIARKKTFKEVANAVKISASLMATVMPKRVKASILYASETVRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
GSPRPEQHRSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKA
AARDIFSPKRSWKRQRYRLSAQVEGLQLLPGLVHVHRRKMFQATVLSVENLQSSKSTRAT
ILVRLDTEGQEGLQYQPGDHIGICPPNRTGLVEALLSRVEDPTPPTESVGVEQLEKGSPG
GPPPSWVRDPRLPPYTLRQALTFFLDITSPPSPRLLRVLSTLAEEPSEQQELETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPTPLLLTQLALLQPRYYSVSSAPSTYPGEIHPTVA
VLAYRTQDGLGPLHYGVCSTWLGQLKPGDPVPCFIRAAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGNME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWTFDPPGP
DTPGP
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcctgggcccccctgcggcctggggctgggg
ctgggccttgggctatgcggcaagcagggcccagccaccccggcacctgagcccagccgg
gccccagcacccgccaccccgcacgcgccagaacacagcccagctcccaacagccccacg
ctgacccggcccccggaggggcccaagttccctcgtgtgaagaactgggaggtggggagc
atcacctatgacaccctgtgcgcccagtcccaacaggatgggccctgcacccccagacgc
tgcctgggctccctggtgttgccccggaaactacagtcccggccctcccccggaccccca
cccgctgagcagctgctgagccaggccagggacttcatcaaccagtactacagctccatt
aagaggagcggctcccaggcccacgaggagcggcttcaggaggtggaggccgaggtggca
accacgggcacctaccacctcggagagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgccccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgct
cgggactgcagctctgcacaggagatgttcacctacatctgcaaccacatcaagtacgcc
accaaccggggcaaccttcgctcggccatcacagtgttcccccagcgcactccaggccgc
ggggacttccggatctggaacagccaactggtgcgctatgcaggctacaggcagcaggac
ggctccgtgcggggggacccagccaacgtggagatcaccgagctctgcatccagcatggc
tggaccccaggaaacggccgctttgatgtgctgcccctgctgctccaggccccagacgag
cctccagaactctttgctttgccccctgagctggtcctcgaggtgcccctggaacacccc
acgctggagtggttcgcggccctgggcttgcgctggtatgccctcccagcagtgtccaac
atgctgctggaaatcgggggcctggagttcccagcggcccccttcagcggctggtacatg
agcacagagattggcacccggaacctgtgcgatcctcaccgctacaacattctggaggat
gtggccgtctgcatggacctggacacccggaccacctcgtccctgtggaaagacaaggca
gctgtggaaatcaacctggctgtgcttcacagttaccagctggccaaagtgaccattgtg
gaccatcacgccgccacggcctccttcatgaagcacctggagaacgagcagaaggccagg
ggcggctgccctgccgactgggcctggatcgtgccccccatctcgggcagcctcacgccc
gtcttccaccaggagatggtcaactatgtcctgtccccggccttccgctaccagccagac
ccctggaaagggagcgcagccaagggcaccggcatcgccagaaagaagacgtttaaggaa
gtggccaacgcggtgaagatctcggcctcactcatggccaccgtgatgccgaagcgagtg
aaggcgtcaattctgtacgcctccgagaccgtccgggcccagagttacgcacagcagctg
gggaggctcttccggaaggctttcgacccccgggtcctgtgcatggatgagtatgacgtg
gtgtccttggagcacgagacgctggtgttggtggtaaccagcacctttgggaacggggat
cccccagagaatggagagagtttcgcggcagccctgatggagatgtcgggcccctacaac
ggctcccctcggcctgaacagcacaggagttacaaaatccgcttcaatagcgtttcctgc
tcagacccgctggtgtcctcctggcggcggaagaggaaggaatccagtaacacagacagc
gcgggggcgctggggaccctcaggttctgtgtgttcgggctgggctcccgggcatacccc
cacttctgtgcctttgctcgtgcggtggacacacggctagaagagctgggtggggagcgc
ctgctccagctgggccagggcgacgagctgtgcggccaggaggaggcctttcgaggctgg
gcccaggccgccttccaggcctcctgtgagactttctgcgtgggggaggatgccaaggct
gccgcacgggacatcttcagccccaaacggagctggaaacgccagagataccggctgagc
gcccaggtggagggcctccagctgctgccaggcctggtccatgtgcacaggcggaaaatg
ttccaggctacggtcctctcggtggaaaacctacaaagcagcaagtccacccgggccacg
atcctggtgcgcctggacactgaaggccaggaggggctccagtaccagccgggggaccac
ataggcatctgcccgcccaaccggacaggtctcgtggaggcgctgctgagccgtgtggag
gacccgacaccgcccaccgagtctgtgggagtggagcagctagagaagggcagccctggt
ggccctcctcccagctgggtgcgggacccccggctgcccccgtacacactgcgacaggct
ctcaccttcttcctggacatcacctccccgcccagccctcggcttcttcgggtgctcagc
accctggctgaagagcccagcgaacagcaggagcttgagaccctcagccaggacccccgg
cgctatgaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttt
ccatccgtggcactgcccaccccgctgctcctcacccagctggctctgctccagccccgg
tactactccgtgagctcggcgcccagcacctacccgggagagatccaccccacagttgca
gtgctggcctacaggacccaagatgggctgggccccctgcactatggagtctgctccacg
tggctgggccagctcaagcctggagaccctgtaccctgcttcatcagggcggctccctcc
ttccggctgccacctgatcccagcttgccctgcatcctggtgggcccaggcacaggcatt
gcccccttccggggattctggcaggagcggctgcatgacattgagagcaaagggctgcag
cccgcccccatgaccttggtgttcggctgccgatgctcccagctcgaccatctctaccgc
gacgaggtgcaggatgcccagcagcgcggggtgtttggacgcgtcctcaccgccttctcc
cgggaacccgacagccctaagacctacgtgcaggacatcctgaggacggagctggctgct
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgacgtcacc
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacggagggcaacatggag
ctggacgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcgggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttt
tccctgcaggagcgacatctgcggggcgcagtgccctggacgttcgaccctcccggccca
gacactcctggcccctga

DBGET integrated database retrieval system