KEGG   Sus scrofa (pig): 397581
Entry
397581            CDS       T01009                                 

Gene name
TXN
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04621  NOD-like receptor signaling pathway
ssc05012  Parkinson disease
ssc05132  Salmonella infection
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    397581 (TXN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    397581 (TXN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    397581 (TXN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    397581 (TXN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397581 (TXN)
Chaperones and folding catalysts [BR:ssc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   397581 (TXN)
SSDB
Motif
Pfam: Thioredoxin DIM1 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_9 Glutaredoxin AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 397581
NCBI-ProteinID: NP_999478
Ensembl: ENSSSCG00000005453
UniProt: P82460 H6TBN0
Position
1
AA seq 105 aa
MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaagcagattgagagcaagtacgcttttcaggaagccttgaacagtgcaggagag
aaactcgtagtggtcgatttctcagccacgtggtgtgggccttgcaaaatgatcaagcct
ttcttccattctctctctgaaaagtattccaatgtcgtgttccttgaagtagatgtggat
gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt
aaaaagggacagaaggtgggtgaattttctggagctaacaaggaaaaacttgaagccacc
attaatgaattaatctaa

DBGET integrated database retrieval system