KEGG   Sus scrofa (pig): 397587Help
Entry
397587            CDS       T01009                                 

Gene name
CAPNS1
Definition
(RefSeq) calpain small subunit 1
  KO
K08583  calpain, small subunit 1
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397587 (CAPNS1)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C2: calpain family
   397587 (CAPNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 397587
NCBI-ProteinID: NP_999483
Ensembl: ENSSSCG00000030149
UniProt: P04574 A0A480VEK3
Structure
PDB: 

Position
6
AA seq 266 aa AA seqDB search
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGTAMRIL
GGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMN
ILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFD
VDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRA
FKSLDKDGTGQIQVNIQEWLQLTMYS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttcctggttaactcgttcctgaagggtggcggcggcggcggcgggggaggcgggggc
ttgggcgggggcctagggaatgtgctcggaggcctgatcagcggggccggaggcggcggt
ggcggcggcggtggcggaggaggcggcggcggtggtggcggaactgccatgcgcatcctg
ggcggggttattagcgccatcagtgaggcggctgcgcagtacaaccccgagcccccgccc
cctcgcacccattattccaacattgaggccaatgagagtgaggaggtccggcagtttcgg
aggctctttgcccagctggctggagatgacatggaggtcagtgccacggaactcatgaac
attctcaacaaggtcgtgacccgacaccctgatctgaagactgatggttttggcattgac
acatgtcgaagcatggtggctgtgatggatagtgacacaaccggcaagctgggcttcgag
gaattcaagtacttgtggaacaacatcaaaaagtggcaggccatatacaaacagttcgat
gttgaccgttcagggaccattggcagcagtgaactcccaggggcctttgaagccgcagga
ttccacctgaatgagcatctctacagcatgatcatccgacgctactcagatgagggaggg
aacatggattttgacaactttatcagctgcctggtcagactggatgccatgttccgtgcc
ttcaaatctcttgacaaagatggtactggacaaatccaggtgaacatccaggagtggctg
cagctgaccatgtattcctga

DBGET integrated database retrieval system