KEGG   Sus scrofa (pig): 397609Help
Entry
397609            CDS       T01009                                 

Gene name
PTN
Definition
(RefSeq) pleiotrophin precursor
  KO
K16642  pleiotrophin
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    397609 (PTN)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   397609 (PTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTN_MK_C PTN_MK_N
Motif
Other DBs
NCBI-GeneID: 397609
NCBI-ProteinID: NP_999501
Ensembl: ENSSSCG00000016522
Vega: OTTSUSG00000001760
UniProt: P79281 A0A480JEP7
Position
18
AA seq 168 aa AA seqDB search
MQTPQFLQQRRKFAAAFLAFIFLLAVVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNADCQKTVTISKPCGKVTKPKPQAESKKKKKEGKKQEKMLD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccacagttcctgcagcagcgtcgaaaatttgcagctgccttcttggcattc
attttccttttggcagttgtggataccgctgaagcaggaaagaaagagaaaccagaaaaa
aaggtgaagaagtctgactgtggagaatggcagtggagtgtgtgtgtgcccaccagtggg
gactgtgggctgggtacccgggagggcacccggactggagctgagtgtaaacaaaccatg
aagacccagagatgtaagatcccgtgcaactggaaaaagcagtttggagcggagtgcaaa
taccagttccaggcctggggcgaatgtgacctgaacacggcattgaagaccagaaccgga
agcctgaagcgagctctccacaacgccgactgccagaagacagtcaccatctccaagccc
tgtggcaaagtgactaagcccaaacctcaagcagaatctaagaagaagaaaaaggaaggc
aagaaacaggagaagatgctggactaa

DBGET integrated database retrieval system