KEGG   Sus scrofa (pig): 397624
Entry
397624            CDS       T01009                                 

Gene name
SLC15A1
Definition
(RefSeq) solute carrier family 15 member 1
  KO
K14206  solute carrier family 15 (oligopeptide transporter), member 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    397624 (SLC15A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    397624 (SLC15A1)
Transporters [BR:ssc02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   397624 (SLC15A1)
SSDB
Motif
Pfam: PTR2 DUF4397 AlgF MFS_2
Other DBs
NCBI-GeneID: 397624
NCBI-ProteinID: NP_999512
Ensembl: ENSSSCG00000009513
UniProt: Q7YSA7
Position
11
AA seq 708 aa
MGMSVPQSCFGYPLSIFFIVVNEFCERFSYYGMRALLILYFRLFIGWNDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQVVMAVSSINDLTDFDHNGTPNSMSV
HVALSMIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSTQACYPLAFGVPAALMAVSLIVFVMGSRMYKKLKPQGNVMAKVVKCI
GFAIKNRFRHRSKKFPKREHWLDWAKEKYDERLICQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMNGQIGLLKIQPDQMQTVNAILIVIMVPIMDAVVYPLIAKCGLNFTSLRK
MTVGMFLASMAFVAAAIVQVEIDKTLPVFPKGNEVQVKVLNIGNNSMSVSFPGTTVTLDQ
MSQTHEFLTFDVNKLTSINISSAGSPATPVTYNFEQGHRHTLLVWGPSHYRVVKDGLNQK
PEKGENGVRFVNTFDESFNVTMDGKVYIDVTSHNASAYQFFPSGAKSFIVHSPEISPQCK
NNFTSSSLEFGSAFTYVITRKEDSCPDLKIFEDISPNTINMALQIPQYFLITCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSEQWAEYVLFAGLLLAVC
IIFAIMARFYTYINPAEVEAQFDMDEKKKYLGKDSLYPKLDTDVQTQM
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgggaatgtccgtgccacagagctgcttcggttatcccttgagcatcttcttcatcgtg
gtcaacgagttctgtgaaaggttttcctactatggaatgagagcactcctgatcctgtac
ttccggcttttcatcggctggaatgacaatctgtccactgccatctaccacacctttgtg
gctctgtgctacctgacgcccattctaggagccctcatcgccgactcctggctggggaag
ttcaagacaattgtgtcgttgtccatcgtctacaccattggacaggtggtcatggccgtg
agctccatcaatgacctcacagacttcgaccacaacggaacccccaacagcatgtctgtg
cacgtggcgctgtccatgatcggcctggccctgattgctctgggtactggcgggataaag
ccctgtgtgtcggcctttgggggcgatcagtttgaagagggccaggaaaagcaaagaaac
cgatttttttccatcttttatttggccattaatgctggaagtttgctttctactatcatc
actcccatgctcagagttcaacaatgtggaattcacagtacccaggcttgctacccactg
gcatttggggttcctgctgctctcatggctgtatctctgattgtgtttgtcatgggcagc
agaatgtacaagaagctcaagccccagggtaatgtcatggccaaagtcgtcaagtgcatc
gggtttgccatcaaaaataggtttaggcatcggagtaagaagtttcccaagagggagcac
tggctggactgggccaaggagaaatatgacgagcggctcatctgtcaaatcaagatggtc
acgcgcgtgatgttcctgtatatcccgctccccatgttctgggctttgtttgaccagcag
ggctccaggtggacactgcaagcaacgaccatgaatgggcaaattgggttgcttaaaatc
cagccggatcagatgcagaccgtcaacgccatcctgatcgttatcatggttcccatcatg
gatgctgtggtgtatcctctgatcgcgaagtgtggtttgaatttcacctccctgaggaag
atgacagttgggatgttcctggcttccatggctttcgtggcagctgccatcgtgcaggtg
gagattgacaaaactcttccagtcttccccaaaggaaatgaagtccaagttaaagtactg
aacataggaaataacagcatgtccgtatcttttcctggaacgacggtgacccttgaccag
atgtctcaaacacacgaatttctgactttcgacgtcaacaaactgacaagtataaacatt
agttctgctggatcaccagccactccagtaacttacaactttgagcagggccatcgccat
acccttctggtgtggggccccagtcactaccgagtggtaaaggacggccttaaccagaag
cctgaaaaaggagaaaacggagtcagatttgtaaatacttttgacgagagcttcaatgtc
acgatggatgggaaagtctacatagatgtcaccagtcacaacgccagcgcctatcagttt
tttccttcaggcgcaaaaagcttcatcgtgcactcaccggagatttcaccgcagtgtaaa
aataatttcacgtcctccagccttgaatttggcagcgcgtttacctatgtgatcacgagg
aaggaggacagctgccccgatctgaagatttttgaggatatttcccccaatacgattaac
atggctctgcagatcccgcagtatttcctcatcacctgcggcgaggtggtcttctctgtc
acgggactggagttctcctattctcaggctccttccaacatgaagtcggtgcttcaagca
ggatggctgttgaccgtggctgttggcaacatcatcgtgcttatcgtggcaggagcaggc
cagttcagtgaacagtgggccgagtacgttctgtttgcggggttgctcctcgccgtctgc
ataatatttgccatcatggctcgattctacacgtacatcaacccagcagaggttgaagct
cagtttgatatggacgaaaagaaaaagtacctgggaaaggatagcctgtaccccaagctg
gacaccgacgtacagacgcagatgtga

DBGET integrated database retrieval system