KEGG   Sus scrofa (pig): 397637Help
Entry
397637            CDS       T01009                                 

Gene name
PPIA
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase A
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    397637 (PPIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ssc03110]
    397637 (PPIA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    397637 (PPIA)
Enzymes [BR:ssc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     397637 (PPIA)
Chaperones and folding catalysts [BR:ssc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    397637 (PPIA)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   397637 (PPIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 397637
NCBI-ProteinID: NP_999518
Ensembl: ENSSSCG00000016737
UniProt: P62936 F2Q9A3
Position
18
AA seq 164 aa AA seqDB search
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggttaaccccaccgtcttcttcgacatcgccgtcgatggcgagcccttgggccgcgtc
tccttcgagctgtttgcagacaaagttccaaagacagcagaaaacttccgtgctctgagc
actggggagaaaggatttggttataaaggttcctgctttcacagaataattccaggattt
atgtgccagggtggtgacttcacacgccataatggcactggtggcaagtccatctatgga
gagaaatttgatgatgagaattttatcctgaagcatacgggtcctggcatcttgtccatg
gcaaatgctggccccaacacaaacggttcccagtttttcatttgcactgccaagactgag
tggttggatggcaaacatgtggtctttggcaaagtgaaagagggcatgaatattgtggaa
gccatggagcgctttgggtccaggaatggcaagaccagcaagaagatcaccattgctgac
tgtggacaaatctaa

DBGET integrated database retrieval system