KEGG   Sus scrofa (pig): 397677Help
Entry
397677            CDS       T01009                                 

Gene name
FOLH1B
Definition
(RefSeq) glutamate carboxypeptidase 2
  KO
K14592  glutamate carboxypeptidase II (folate hydrolase 1) [EC:3.4.17.21]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00250  Alanine, aspartate and glutamate metabolism
ssc01100  Metabolic pathways
ssc04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    397677 (FOLH1B)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    397677 (FOLH1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    397677 (FOLH1B)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     397677 (FOLH1B)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   397677 (FOLH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFR_dimer Peptidase_M28 PA
Motif
Other DBs
NCBI-GeneID: 397677
NCBI-ProteinID: NP_999549
Ensembl: ENSSSCG00000027093
UniProt: O77564
Position
9
AA seq 751 aa AA seqDB search
MWNPLHETDSTSVAWRRPRWLCAGALVLAAGLFVLGFLFGWFIKSPNEAANISPQHNVKK
AFLDELKAENIKTFLYNFTRIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSY
PNKTRPNYISIIDEDGNEIFNTSLFEPPPPGYENVSDVVPPFSAFSPQGMPEGDLVYVNY
ARTEDFFKLERDMKINCSGKILIARYGKIFRGNKVKNAQLAGAKGIILYSDPADYFAPGV
QSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRLQIAEAVGLPRIPVHPIGY
SDAQKLLEKMGGSAPPDDSWKGSLHVPYNVGPGFTGNFSTQKVKMHIHSDNKVKRIYNVI
GTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGKLKKEGWRPRRTVLFA
SWDAEEYGLFGSTEWAEENSRILQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTK
ELQSPDEGFEGKSLFESWNEKSPSPEFSGLPRISKLGSGNDFEVFFQRLGIASGRARYTK
DWVTNKFSSYPLYHSVYETYELVEKFYDPTFKYHLAVAQVRGGIVFELANSVVRPFDCRD
YAVVLRNYADKLYNISMNHPQEMKAYSVSFDSLFSAVKNFTEIASNFSERVQDLDKNNPI
LLRIMNDQLMFLERAFIVPLGLPDRAFYRHVIYAPSSHNKYMGESFPGIYDALFDIENKV
DPSKAWGEVKRQISIAAFTVQAAAGTLREVA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacccccttcacgaaaccgactcgacctctgtcgcctggcgccgcccgcgctgg
ctgtgcgctggggccctggtgctggccgccggcctcttcgtcctcggcttcctcttcgga
tggtttataaaatctcccaatgaagctgctaacattagtcctcagcataatgtgaagaaa
gcatttttggatgagttgaaagcagagaacatcaagacattcttatataattttacccgg
ataccacatttagctggaacagaacagaactttcagcttgcaaagcaaattcaatctcag
tggaaagaatttggcctggattctgttgagttagcccattatgatgtgctgttgtcctat
ccaaataagactcgccccaactacatctcaataattgatgaagatggaaatgagattttc
aacacatcattatttgaaccacctcctcctggatatgaaaatgtttcagatgttgtgcca
ccttttagtgccttctctccacaaggaatgccagagggtgacctggtgtatgtgaactat
gcacgaaccgaagacttctttaaattagagcgagacatgaaaatcaattgctctgggaag
attctgatcgccagatatgggaaaattttcagaggaaataaggttaaaaatgcccagctg
gcgggggccaaaggcatcattttgtactcagaccctgctgattactttgctcctggggtg
cagtcctatccggatggttggaatcttcctggagggggtgttcagcgtggaaatatctta
aatcttaatggtgcaggcgaccctctcacacccggttacccagcaaatgaatacgcttac
agacttcaaatcgcagaggctgttggtcttccaaggattcctgttcatccgattggctac
tctgatgcacagaagctcctggaaaaaatgggtggatccgcacccccagatgacagttgg
aaaggaagtctccacgtgccttacaatgtcggtcctggttttactggaaacttttctacc
caaaaagtcaaaatgcacatccattccgacaataaagtgaagagaatttacaatgtgatt
ggaactctcagaggggcggtggaaccagacagatatgtcattcttggaggacaccgtgac
tcatgggtcttcggtggcattgaccctcagagtggagcagctgtggttcatgaaattgtc
aggagttttggaaagctgaaaaaagaaggatggaggccgagaagaacagttttatttgca
agctgggatgcagaagaatatggtctctttggttccactgagtgggcagaggagaattcc
agaatccttcaagagcgtggtgtggcttatattaatgctgattcttctatagaaggaaac
tacactctgagagttgattgtacccccctgatgtacagcctggtgtacaacctaacaaag
gagctccaaagtcctgatgaagggtttgaaggcaaatctctttttgagagctggaatgaa
aaaagtccttcacctgaattcagtggcttgcccaggattagcaaattaggatctggtaat
gattttgaagtgttcttccaaagacttggaattgcttcaggcagagcgcggtatactaaa
gattgggtaaccaacaaattcagcagctatccactgtatcacagtgtctatgaaacgtat
gaattagtggaaaagttttatgacccaacttttaagtatcatcttgctgtggcccaggtt
cgaggaggaattgttttcgaacttgccaattctgtagtgcgcccttttgactgtcgagat
tatgctgtagttttaagaaattatgctgataaactctacaatatttcaatgaaccatcca
caagaaatgaaagcatacagtgtgtcgtttgattcactcttctctgcagtgaagaatttt
acagaaatcgcttctaacttcagcgagagagtccaagacttggataaaaacaatccaata
ttgttaagaattatgaatgatcaactgatgtttttggaacgagcatttattgttccttta
ggattgccagacagggctttctacaggcatgtcatctatgctccaagcagccacaacaag
tacatgggggagtcattcccagggatctatgacgctctgtttgatattgaaaacaaagtg
gatccttccaaggcctggggcgaagtgaagagacagatttctattgcagccttcacagtg
caggccgcagcagggactctgagagaagtagcctaa

DBGET integrated database retrieval system