KEGG   Sus scrofa (pig): 399500
Entry
399500            CDS       T01009                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01523  Antifolate resistance
ssc04060  Cytokine-cytokine receptor interaction
ssc04061  Viral protein interaction with cytokine and cytokine receptor
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04640  Hematopoietic cell lineage
ssc04657  IL-17 signaling pathway
ssc04659  Th17 cell differentiation
ssc04668  TNF signaling pathway
ssc04672  Intestinal immune network for IgA production
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05010  Alzheimer disease
ssc05020  Prion disease
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05143  African trypanosomiasis
ssc05144  Malaria
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05321  Inflammatory bowel disease
ssc05323  Rheumatoid arthritis
ssc05332  Graft-versus-host disease
ssc05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    399500 (IL6)
   04668 TNF signaling pathway
    399500 (IL6)
   04066 HIF-1 signaling pathway
    399500 (IL6)
   04068 FoxO signaling pathway
    399500 (IL6)
   04151 PI3K-Akt signaling pathway
    399500 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    399500 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    399500 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    399500 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    399500 (IL6)
   04620 Toll-like receptor signaling pathway
    399500 (IL6)
   04621 NOD-like receptor signaling pathway
    399500 (IL6)
   04623 Cytosolic DNA-sensing pathway
    399500 (IL6)
   04625 C-type lectin receptor signaling pathway
    399500 (IL6)
   04659 Th17 cell differentiation
    399500 (IL6)
   04657 IL-17 signaling pathway
    399500 (IL6)
   04672 Intestinal immune network for IgA production
    399500 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    399500 (IL6)
   05202 Transcriptional misregulation in cancer
    399500 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    399500 (IL6)
   05321 Inflammatory bowel disease
    399500 (IL6)
   05332 Graft-versus-host disease
    399500 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    399500 (IL6)
   05020 Prion disease
    399500 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    399500 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    399500 (IL6)
   04931 Insulin resistance
    399500 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    399500 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    399500 (IL6)
   05135 Yersinia infection
    399500 (IL6)
   05133 Pertussis
    399500 (IL6)
   05134 Legionellosis
    399500 (IL6)
   05152 Tuberculosis
    399500 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    399500 (IL6)
   05162 Measles
    399500 (IL6)
   05164 Influenza A
    399500 (IL6)
   05161 Hepatitis B
    399500 (IL6)
   05168 Herpes simplex virus 1 infection
    399500 (IL6)
   05163 Human cytomegalovirus infection
    399500 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    399500 (IL6)
   05169 Epstein-Barr virus infection
    399500 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    399500 (IL6)
   05144 Malaria
    399500 (IL6)
   05142 Chagas disease
    399500 (IL6)
   05143 African trypanosomiasis
    399500 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    399500 (IL6)
   01523 Antifolate resistance
    399500 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    399500 (IL6)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Interleukins
   399500 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 FtsH_ext
Other DBs
NCBI-GeneID: 399500
NCBI-ProteinID: NP_999564
Ensembl: ENSSSCG00000027850
Vega: OTTSUSG00000001460
UniProt: P26893 A4D862
Position
9
AA seq 212 aa
MNSLSTSAFSPVAFSLGLLLVMATAFPTPGRLEEDAKGDATSDKMLFTSPDKTEELIKYI
LGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLV
EFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQ
SQNEWMKNTKIILILRSLEDFLQFSLRAIRIM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaagcgccttcagtccagtcgccttctccctggggctgcttctg
gtgatggctactgccttccctaccccgggacgcctggaagaagatgccaaaggtgatgcc
acctcagacaaaatgctcttcacctctccggacaaaactgaagaactcattaagtacatc
ctcggcaaaatctctgcaatgagaaaggagatgtgtgagaagtatgagaagtgtgaaaac
agcaaggaggtactggcagaaaacaacctgaaccttccaaaaatggcagaaaaagacgga
tgcttccaatctgggttcaatcaggagacctgcttgatgagaatcaccaccggtcttgtg
gagtttcagatatacctggactacctccagaaagagtatgagagcaataagggaaatgtc
gaggctgtgcagattagtaccaaagcactgatccagaccctgaggcaaaagggaaagaat
ccagacaaagccaccacccctaaccccaccacaaatgccggcctgctggataagctgcag
tcacagaacgagtggatgaagaacacaaagatcattctcatcctgcgcagccttgaggat
ttcctgcagttcagcctgagggccattcggataatgtag

DBGET integrated database retrieval system