KEGG   Sus scrofa (pig): 399501Help
Entry
399501            CDS       T01009                                 

Gene name
ADRA2A
Definition
(RefSeq) alpha-2A adrenergic receptor
  KO
K04138  adrenergic receptor alpha-2A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04022  cGMP-PKG signaling pathway
ssc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    399501 (ADRA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    399501 (ADRA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    399501 (ADRA2A)
G protein-coupled receptors [BR:ssc04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    399501 (ADRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Piezo_RRas_bdg
Motif
Other DBs
NCBI-GeneID: 399501
NCBI-ProteinID: NP_999565
Ensembl: ENSSSCG00000010629
UniProt: P18871
Position
14
AA seq 450 aa AA seqDB search
MGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGG
QQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAA
ALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSE
HAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggctccctgcagccggaagcgggcaacgcgagctggaatgggacagaggcgccgggg
ggcggcgcccgggccaccccctactccctgcaggtgacactgacgctggtgtgcctggcc
ggcctgctcatgctgttcaccgtgttcggcaacgtgcttgtcatcattgccgtgttcaca
agccgcgcgctcaaggcgccccagaacctcttcctggtgtctctggcctcggctgacatc
ctagtggccacgcttgtcatccctttctcgctggccaacgaggtcatgggctactggtac
ttcggcaaggcgtggtgtgagatctacctggcgctcgacgtgctcttctgcacgtcgtcc
atcgtgcacctgtgtgccatcagcttggatcgttactggtccatcacccaggccatagag
tacaacctgaagcgcacgccacgccgcatcaaagcaatcatcgtcaccgtgtgggtcatc
tcggccgtcatctccttcccgccgctcatctccatcgagaagaaggcaggcggcggtggc
cagcagccggccgaaccgcgctgcgagatcaacgaccagaagtggtacgtcatctcgtct
tgcatcggctccttcttcgcgccctgcctcatcatgatcctggtctatgtgcgcatctat
cagatagccaagcgccgcacccgcgtgccgcccagccgccggggtcctgatgcggccgcc
gcgctgccggggggcgccgagcgcaggcccaatggcctaggccccgagcgcggcgtgggt
cgcgtgggcgccgaggccgagccgctacccgtccagctcaacggtgccccgggggagccc
gcgcccgctgggccccgcgacgctgacgggctggacctcgaggagagctcctcgtctgag
cacgccgagcggccccctgggccccgcaggtccgagcgcggccctcgggccaagagcaag
gctcgggcgagccaggtaaagcccggggacagcctgccacggcgcgggccgggggcgccc
gggccgggggcgcccgcgactggggccggggaggagcgcggcggggtcgccaaggcgtcg
cgctggcgcggaaggcagaaccgcgagaagcgcttcactttcgtgctggcggtggtcata
ggcgtgttcgtggtctgttggttccccttcttcttcacctatacgctcacggccgtaggc
tgctcggtgccgcccactctcttcaagttcttcttctggttcggctactgcaacagctcg
ctgaatccggttatctacaccatcttcaatcacgacttccgccgcgccttcaagaagatc
ctctgccgtggggacaggaaacggatcgtgtga

DBGET integrated database retrieval system