KEGG   Sus scrofa (pig): 399542Help
Entry
399542            CDS       T01009                                 

Gene name
SLC5A5
Definition
(RefSeq) sodium/iodide cotransporter
  KO
K14385  solute carrier family 5 (sodium/iodide cotransporter), member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    399542 (SLC5A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    399542 (SLC5A5)
Transporters [BR:ssc02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   399542 (SLC5A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF NdhL
Motif
Other DBs
NCBI-GeneID: 399542
NCBI-ProteinID: NP_999575
Ensembl: ENSSSCG00000013890
UniProt: Q9GJX7
Position
2
AA seq 643 aa AA seqDB search
MATVEGGARATFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLTAVPVG
LSLSASFMSAVQVLGVPAEAYRYGLKFLWMCLGQLLNSLLTALLFLPVFYRLGLTSTYQY
LELRFSRAVRLCGTLQYLVATMLYTGVVIYAPALILNQVTGLDIWASLLSTGIICTFYTT
VGGMKAVIWTDVFQVLVMLTGFWVVLARGTVLVGGPGRVLELAKNHSRINLMDFDLDPRR
RYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAAACG
IVMFALYVDCDPLLAGHISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSIN
AMAAVTVEDLIKPRLPNLAPRRLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
GVISGPLLGAFVLGMFLPSCNTSGVLSGLAAGLALSLWVAVGASLYPPSAQSMGVLPSSA
AGCALPTANASGLQDPVLAVNASSTASSLETDPEQPILAASFYAISYLYYGALGTLSTIL
CGALISCLTGPTKRSALGPGLLWWDLTRQTASVAPKEEVAALDDSLMKQGAEELPLAIKK
PPDFLSTNEDHLLFLGQKEVNGASSKTPGSEHDKGHDLRETDL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgtcgagggaggcgcgcgggccacgttcggagcctgggactacggagtcttc
gccctcatgctgctggtgtccactggcatcgggctgtgggttgggctggcgcggggtggg
cagcgcagcgccgaggacttcttcaccgggggccggcgcctgacggccgtgcccgtcggc
ctctcgctgtccgccagcttcatgtcggcggtacaggtgctaggcgtgccagcggaggcc
taccgctatggcctcaagttcctctggatgtgcctgggacagctgctcaactcgctgctc
actgccctactcttcctcccagttttctaccgcctgggcctcaccagcacttaccagtac
ctggagctgcgcttcagccgcgctgtgcggctctgcgggaccctgcagtacctggtggct
acaatgctgtacactggcgtcgtaatctacgcccccgcgctcatcctgaaccaagtgacg
gggctggatatctgggcttcactcctatccactggaatcatctgcaccttctacactact
gtgggtggcatgaaggctgtgatctggactgacgtgtttcaggtcttagtgatgctgact
ggtttctgggttgtcctggctcgcggaactgtgctcgtgggtgggcctggacgtgtgctt
gagcttgccaagaaccactcccggatcaacctgatggactttgatctggacccgaggcgc
cgctacaccttctggacttttgtcgtgggtggcaccttggtatggctctcaatgtatgga
gtgaaccaagcacaggtgcagcgctacgtggcctgtcgcacagagaagcaagctaagttg
gccctgctcatcaaccaggtgggcctgttcctaatcgtgtccagcgctgctgcctgtggt
attgtcatgttcgcgctctacgttgactgtgaccctctcctggcagggcatatctctgcc
ccagaccagtacatgcccctgctggtgctggacatctttgaagacctgcctggagtccct
gggctctttctggcctgtgcctacagcggcaccctcagcactgcatccaccagcatcaat
gccatggctgctgtcactgtggaggacctcatcaaacctcggctgccaaacctggctcca
cggagactcgtaatcatctccaaggggctctcactcatctacggctcagcctgtctcacg
gtggcggctctgtcttccctgctggggggcggcgtcctccagggctcattcaccgtcatg
ggagtcatcagcggccccctcctcggagcctttgttctgggaatgttcctcccctcctgc
aatacgtcgggcgtcctgtccgggctggcggcgggcttggcgctgtcgctgtgggtggcc
gtgggcgcctctttgtacccgcctagtgcgcagtccatgggggtcctgccgtcgtcggcc
gccggctgcgctctgcctacagccaacgcctctggcctccaggacccggtccttgccgtc
aacgcctccagcacggcctccagccttgaaacggaccctgaacaacccatcttagctgca
agcttctacgccatttcctatctctattatggtgccctgggcaccctgagcaccatacta
tgtggagccctcatcagctgcctgactggccccaccaagcgcagtgccctgggtcccggt
ctgctgtggtgggacctcacacggcagacggcatcggtggcccccaaggaagaagtggct
gccctggatgacagcctgatgaagcagggtgctgaggaattgcctttggcaatcaagaag
cctcctgacttcctgtccactaatgaggaccatctgctctttctggggcagaaggaggtg
aatggagccagctccaagaccccaggcagtgaacatgacaaaggtcatgacctgcgtgag
acggacctctaa

DBGET integrated database retrieval system