KEGG   Sus scrofa (pig): 403155
Entry
403155            CDS       T01009                                 

Gene name
SLC25A6
Definition
(RefSeq) ADP/ATP translocase 3
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04217  Necroptosis
ssc04218  Cellular senescence
ssc04613  Neutrophil extracellular trap formation
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05164  Influenza A
ssc05166  Human T-cell leukemia virus 1 infection
ssc05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    403155 (SLC25A6)
   04022 cGMP-PKG signaling pathway
    403155 (SLC25A6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    403155 (SLC25A6)
   04218 Cellular senescence
    403155 (SLC25A6)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    403155 (SLC25A6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    403155 (SLC25A6)
   05164 Influenza A
    403155 (SLC25A6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    403155 (SLC25A6)
   05012 Parkinson disease
    403155 (SLC25A6)
   05016 Huntington disease
    403155 (SLC25A6)
   05017 Spinocerebellar ataxia
    403155 (SLC25A6)
   05020 Prion disease
    403155 (SLC25A6)
   05022 Pathways of neurodegeneration - multiple diseases
    403155 (SLC25A6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    403155 (SLC25A6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssc03029]
    403155 (SLC25A6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssc02000]
    403155 (SLC25A6)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    403155 (SLC25A6)
Transporters [BR:ssc02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   403155 (SLC25A6)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 403155
NCBI-ProteinID: NP_999583
UniProt: Q6QRN9
AA seq 298 aa
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSATEREFKGLGDCLVKITKSDGIRGLYQGFNVS
VQGIIIYRAAYFGVYGTAKGMLPDPRNTHIVVSWMIAQTVTAVAGVFSYPFDTVRRRMMM
QSGRKGADIMYKGTLDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
NT seq 897 nt   +upstreamnt  +downstreamnt
atgacggaacaggccatctccttcgccaaggactttctggccggaggcattgccgccgcc
atctccaagacggccgtggcccccattgagcgggtcaagctgctgttacaggtgcagcac
gccagcaagcagatcgcggccgacaagcagtacaagggcatcgtggactgcatcgtgcgc
atccccaaggagcagggcgtgctgtccttctggaggggcaacctggccaatgtcatccgc
tacttccccacgcaagccctcaacttcgccttcaaggataagtacaagcagattttcctg
ggcggcgtggacaagcacacgcagttctggaggtatttcgccggcaacctggcctccggc
ggcgcggccggcgccacctccctctgcttcgtctaccccctggatttcgcccgaacccgc
ctggctgccgacgtggggaaatccgccaccgagcgggagttcaaaggcctgggcgactgt
ctggtgaagatcaccaagtctgacggcatccgggggctgtaccagggcttcaacgtgtcg
gtgcagggaatcatcatctaccgggcggcctacttcggcgtgtacggcacggccaagggc
atgctccccgaccccaggaacacgcacattgtggtgagctggatgatcgcgcagaccgtg
acggccgtggcgggcgtgttctcctaccctttcgacaccgtgcggcggcggatgatgatg
cagtccgggcgcaagggagccgacatcatgtacaagggcaccctggactgctggcggaag
atcttcaaggacgagggcggcaaggccttcttcaagggcgcctggtccaacgtgctgcga
ggcatgggcggcgccttcgtgctggtcctgtacgacgagctgaagaaggtcatttag

DBGET integrated database retrieval system