KEGG   Sus scrofa (pig): 408053
Entry
408053            CDS       T01009                                 

Gene name
HAS3
Definition
(RefSeq) hyaluronan synthase 3
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    408053 (HAS3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     408053 (HAS3)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  O-Glycan
   408053 (HAS3)
SSDB
Motif
Pfam: Glyco_tranf_2_3 Chitin_synth_2 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 DUF1294
Other DBs
NCBI-GeneID: 408053
NCBI-ProteinID: NP_001001268
UniProt: Q75R37 A0A4X1VJZ0
Position
6
AA seq 553 aa
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGRPLKLPSPLQRSVALCIAAYQEDPDYLRKCLRSAQRIAFPDLKVVM
VVDGNRQEDAYMLDIFHEVLGGNEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRNVVRA
STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTFEMLRVLEEDPQVGG
VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS
YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG
LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG
KKPEQYSLAFAEV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgccggttcagctgacgacagccctgcgtgtggtgggcaccagcctgtttgccctggca
gtgctgggcggcattctggcagcatatgtgacaggctaccagttcatccacacagaaaag
cactacctgtcctttgggctgtatggtgccatcctgggcctgcacctgctcatccagagc
ctgtttgccttcctggagcaccggcgcatgcggcgggcaggccggccactgaagctgccc
tccccgctgcagcgctcagtggcgctctgcatcgccgcgtaccaggaggaccccgactac
ttgcgcaagtgcctgcgctcggcccagcgcatcgccttccccgatctcaaggtggtcatg
gtggtggacggcaatcgccaggaggatgcctacatgttggacatcttccacgaggtgcta
ggtggcaacgagcaagccggcttctttgtgtggcgcagcaacttccatgaggcgggtgag
ggcgagacggaggccagcctgcaggagggcatggaccgtgtgcggaatgtggtgcgggcc
agcaccttctcctgcatcatgcagaagtggggaggaaagcgagaggtcatgtacacggcc
ttcaaggcccttggtgactccgtggactacattcaggtgtgtgactctgacactgtactg
gatccagcctgtaccttcgagatgcttcgagtcttggaggaggacccccaagtaggggga
gttgggggagatgtccaaatcctcaataagtatgactcctggatctccttcctgagcagt
gtgcggtactggatggccttcaacgtggaacgggcttgccagtcctacttcggctgtgtg
cagtgtatcagtgggcccctgggcatgtaccggaacagcctgcttcagcagttcttggag
gactggtaccatcagaagttcctaggtagcaagtgcagttttggggatgaccggcacctc
accaaccgagtcctgagtctcggctacaggactaagtacacagcacgctctaaatgcctc
acagagacccccaccaagtacctccggtggctcaaccaacagacccgctggagcaagtct
tacttccgggagtggctctacaactctctgtggttccacaagcaccacctctggatgacc
tacgagtcagtggtcacaggttttttccccttcttccttattgccacagtcatacagctt
ttctaccgtggccgcatctggaacattctcctcttcctgctgacagtgcagttggtaggc
atcatcaaggctacctatgcctgctttcttcggggcaatgcagagatgatcttcatgtct
ctctactcccttctctacatgtccagcctcctgccagccaagatcttcgccattgctacc
atcaacaaatctggctggggcacttctggccgaaaaaccattgtggtgaacttcattggc
ctcatccctgtgtccatctgggtggcagtccttctggggggactggcctatacagcttac
tgtcaggacctgttcagtgagacggagctagccttcctggtctcaggggccatcctttat
ggctgctactgggtggccctccttatgctgtatctggccatcatcgcccggcggtgcggg
aagaagccggagcagtatagcttagcttttgctgaggtgtga

DBGET integrated database retrieval system