KEGG   Sus scrofa (pig): 414396
Entry
414396            CDS       T01009                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04145  Phagosome
ssc04210  Apoptosis
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc04530  Tight junction
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04670  Leukocyte transendothelial migration
ssc04714  Thermogenesis
ssc04810  Regulation of actin cytoskeleton
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04971  Gastric acid secretion
ssc05014  Amyotrophic lateral sclerosis
ssc05100  Bacterial invasion of epithelial cells
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05164  Influenza A
ssc05205  Proteoglycans in cancer
ssc05225  Hepatocellular carcinoma
ssc05410  Hypertrophic cardiomyopathy
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
ssc05414  Dilated cardiomyopathy
ssc05416  Viral myocarditis
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    414396 (ACTB)
   04390 Hippo signaling pathway
    414396 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    414396 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    414396 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    414396 (ACTB)
   04520 Adherens junction
    414396 (ACTB)
   04530 Tight junction
    414396 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    414396 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    414396 (ACTB)
   04613 Neutrophil extracellular trap formation
    414396 (ACTB)
   04670 Leukocyte transendothelial migration
    414396 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    414396 (ACTB)
   04919 Thyroid hormone signaling pathway
    414396 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    414396 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    414396 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    414396 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    414396 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    414396 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    414396 (ACTB)
   05135 Yersinia infection
    414396 (ACTB)
   05100 Bacterial invasion of epithelial cells
    414396 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    414396 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    414396 (ACTB)
   05410 Hypertrophic cardiomyopathy
    414396 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    414396 (ACTB)
   05414 Dilated cardiomyopathy
    414396 (ACTB)
   05416 Viral myocarditis
    414396 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ssc03021]
    414396 (ACTB)
   03019 Messenger RNA biogenesis [BR:ssc03019]
    414396 (ACTB)
   03036 Chromosome and associated proteins [BR:ssc03036]
    414396 (ACTB)
   03029 Mitochondrial biogenesis [BR:ssc03029]
    414396 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    414396 (ACTB)
   04147 Exosome [BR:ssc04147]
    414396 (ACTB)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     414396 (ACTB)
Messenger RNA biogenesis [BR:ssc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     414396 (ACTB)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     414396 (ACTB)
    NuA4 complex
     414396 (ACTB)
  Chromatin remodeling factors
   BAF complex
    414396 (ACTB)
   PBAF complex
    414396 (ACTB)
   SWR1 complex
    414396 (ACTB)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    414396 (ACTB)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     414396 (ACTB)
Exosome [BR:ssc04147]
 Exosomal proteins
  Proteins found in most exosomes
   414396 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 414396
NCBI-ProteinID: XP_003124328
Ensembl: ENSSSCG00000007585
UniProt: Q6QAQ1
Structure
PDB: 
6F1T 5AFU 5ADX 6F38 6F3A

Position
3
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc
tttgcgggcgacgatgctccccgggccgtcttcccctccatcgtggggcgcccccgacac
cagggcgtgatggtgggcatgggccagaaggactcctacgtgggggacgaggcccagagc
aagagaggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaagccaaccgtgagaagatgacc
cagatcatgttcgagaccttcaacaccccagccatgtacgtggccatccaggccgtgctg
tccctgtacgcctctggccgcaccactggcatcgtgatggactccggagacggggtcacc
cacacggtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg
gctggccgggacctgaccgactacctcatgaagatcctgacggagcggggctacagcttc
accaccacggccgagcgggagatcgtgcgggacatcaaggagaagctgtgctacgtcgcc
ctggacttcgagcaggagatggccactgccgcgtcctcctcctccctggagaagagctac
gagctgcccgacggccaggtcatcaccatcggcaacgagcgcttccgctgccccgaggcg
ctcttccagccctccttcctgggcatggaatcctgcggcatccacgaaactaccttcaac
tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtcg
ggtggcaccaccatgtacccaggcatcgccgacaggatgcagaaggagatcacggccctg
gcgcccagcacgatgaagatcaagatcatcgcgcctccagagcgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system