KEGG   Sus scrofa (pig): 414412Help
Entry
414412            CDS       T01009                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00020  Citrate cycle (TCA cycle)
ssc00190  Oxidative phosphorylation
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04714  Thermogenesis
ssc04932  Non-alcoholic fatty liver disease (NAFLD)
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05016  Huntington disease
Module
ssc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    414412 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    414412 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    414412 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    414412 (SDHB)
   05012 Parkinson disease
    414412 (SDHB)
   05016 Huntington disease
    414412 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    414412 (SDHB)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     414412 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 414412
NCBI-ProteinID: NP_001098423
Ensembl: ENSSSCG00000020926
UniProt: Q007T0
Structure
PDB: 

Position
6
AA seq 280 aa AA seqDB search
MAAVVAVSLKRWFPATTLGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcggtctccttgaaacgctggttcccggccacaacccttggcgga
gcctgcctgcaggcctgccgtggggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctatcgatgggacccagacaagactggagataaacctcatatgcaaact
tatgaaattgatttgaataactgtggtcctatggtgttggatgcgttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcgtgtagagaaggcatctgcggctcc
tgcgccatgaacatcaacggaggcaacactctggcttgcacccgaagaattgacaccaac
ctcgacaaagtttcaaaaatctaccctcttccacatatgtatgtgataaaggatcttgtt
cctgatttgagcaatttctatgctcagtacaaatccatcgagccttatctaaagaagaag
gatgaatcccaggaaggcaagcagcagtacctgcagtccatagaggagcgcgagaaactg
gatgggctgtacgagtgtattctttgcgcctgctgcagcaccagctgcccgagctactgg
tggaatggagacaagtacctgggacccgcagtcctcatgcaggcctatcgctggatgatc
gactccagagatgacttcacggaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacggggacctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacctacaaggagaagaaagcttcagcc
tga

DBGET integrated database retrieval system